DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hong-2009-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hong SK., Dawid IB. DIP original experiment: DIP-133724X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx FGF-dependent left-right asymmetry patterning in zebrafish is mediated by Ier2 and Fibp1. Hong SK., Dawid IB. Only protein-protein interactions imex curation hong-2009-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hong SK., Dawid IB. DIP original experiment: DIP-133725X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx FGF-dependent left-right asymmetry patterning in zebrafish is mediated by Ier2 and Fibp1. Hong SK., Dawid IB. Only protein-protein interactions imex curation hong-2009-5 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hong SK., Dawid IB. DIP original experiment: DIP-133726X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx FGF-dependent left-right asymmetry patterning in zebrafish is mediated by Ier2 and Fibp1. Hong SK., Dawid IB. Only protein-protein interactions imex curation ier2_danre Immediate early response gene 2 protein ier2 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MDVTAEAKQIMVQALGKMYSSRSQRGGLRLHRSLLLTLVMKSARDIYHSARLMSEKSGQSVTEECTSHTQEPMDTSSSTATPLRETSGQSSEDGQRSGLEGHPHPLNPAADKENCGPSRPDRHSRKRRSKTATDSDFIPCKKAKLECAEVRGVLQNSSANCGRALDSLSLVPMPRTIVTF fibp_danre Acidic fibroblast growth factor intracellular-binding protein B fibpb fibpl FGF-1 intracellular-binding protein B protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MELDVFVGNTTVLDEDIYQLWLDGHSVSDVVRQRMDAGVLLECEASPDVLQSDTIDQFRTFQMCERLLQSPSKVANQLLFQIPSDQQAMLIERYYEFDSVFAREVLGKKLSKGTKKDLDDVSAKTGIALKSCRRQFDNFKRVFKVVEELKGPLVENIQRHFLLSDDLARDYATIVFFANSRFETGKRKLQYLSFQDFAFCAGQLISYWTVGAVDNMIEDMDVDLEKDFLHDLKDLKVLVNDKDLLDQHKSLVCGQLRGKIKVFNEMEASFKNLSRALVNIASKLTHAKDVRDLFIDLVEKFIEPCRSDKWTSGDLRLFLTHYSTSVHTLEAFRHQVIWDRYMGVIKSCILKMYHD ier2-fibpb-1 3183079 N/A 3183082 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3183083 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false ier2-fibpb-2 3183080 N/A 3183082 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3183083 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false fibpb-ier2-1 3183081 N/A 3183082 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3183083 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false