DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ simonetta-2009-4 in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Simonetta M., Manzoni R., Mosca R., Mapelli M., Massimiliano L., Vink M., Novak B., Musacchio A., Ciliberto A. DIP original experiment: DIP-132547X PLoS biology 2009 IMEx The influence of catalysis on mad2 activation dynamics. Simonetta M., Manzoni R., Mosca R., Mapelli M., Massimiliano L., Vink M., Novak B., Musacchio A., Ciliberto A. Only protein-protein interactions imex curation simonetta-2009-5 in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined Simonetta M., Manzoni R., Mosca R., Mapelli M., Massimiliano L., Vink M., Novak B., Musacchio A., Ciliberto A. DIP original experiment: DIP-132549X PLoS biology 2009 IMEx The influence of catalysis on mad2 activation dynamics. Simonetta M., Manzoni R., Mosca R., Mapelli M., Massimiliano L., Vink M., Novak B., Musacchio A., Ciliberto A. Only protein-protein interactions imex curation simonetta-2009-6 in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined Simonetta M., Manzoni R., Mosca R., Mapelli M., Massimiliano L., Vink M., Novak B., Musacchio A., Ciliberto A. DIP original experiment: DIP-132548X PLoS biology 2009 IMEx The influence of catalysis on mad2 activation dynamics. Simonetta M., Manzoni R., Mosca R., Mapelli M., Massimiliano L., Vink M., Novak B., Musacchio A., Ciliberto A. Only protein-protein interactions imex curation cdc20_human Cell division cycle protein 20 homolog CDC20 p55CDC protein protein human Homo sapiens Human MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR md2l1_human Mitotic spindle assembly checkpoint protein MAD2A MAD2L1 MAD2 Mitotic arrest deficient 2-like protein 1 protein protein human Homo sapiens Human MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND cdc20-mad2l1-10 3182730 N/A 3182733 unspecified role unspecified role bait bait Region 111-138 Region 111-138 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3182734 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false cdc20-mad2l1-11 3182731 N/A 3182733 unspecified role unspecified role bait bait Region 111-138 Region 111-138 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 3182734 unspecified role unspecified role prey prey Alexa488-tag Alexa488-tag alexa 488 label alexa 488 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false cdc20-mad2l1-12 3182732 N/A 3182733 unspecified role unspecified role bait bait Region 111-138 Region 111-138 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 3182734 unspecified role unspecified role prey prey Alexa488-tag Alexa488-tag alexa 488 label alexa 488 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false