DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dalhus-2009-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Dalhus B., Arvai AS., Rosnes I., Olsen ØE., Backe PH., Alseth I., Gao H., Cao W., Tainer JA., Bjørås M. DIP original experiment: DIP-132940X Nature structural & molecular biology 2009 IMEx Structures of endonuclease V with DNA reveal initiation of deaminated adenine repair. Dalhus B., Arvai AS., Rosnes I., Olsen ØE., Backe PH., Alseth I., Gao H., Cao W., Tainer JA., Bjørås M. Only protein-protein interactions imex curation nfi_thema Endonuclease V nfi Deoxyinosine 3'endonuclease Deoxyribonuclease V TM_1865 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MDYRQLHRWDLPPEEAIKVQNELRKKIKLTPYEGEPEYVAGVDLSFPGKEEGLAVIVVLEYPSFKILEVVSERGEITFPYIPGLLAFREGPLFLKAWEKLRTKPDVVVFDGQGLAHPRKLGIASHMGLFIEIPTIGVAKSRLYGTFKMPEDKRCSWSYLYDGEEIIGCVIRTKEGSAPIFVSPGHLMDVESSKRLIKAFTLPGRRIPEPTRLAHIYTQRLKKGLF 84250E645E410445 endov-1 3182506 N/A 3182507 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false