DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ quistgaard-2009-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. DIP original experiment: DIP-132934X Nature structural & molecular biology 2009 IMEx Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. Only protein-protein interactions imex curation quistgaard-2009-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. DIP original experiment: DIP-132937X Nature structural & molecular biology 2009 IMEx Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. Only protein-protein interactions imex curation quistgaard-2009-3 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. DIP original experiment: DIP-132935X Nature structural & molecular biology 2009 IMEx Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. Only protein-protein interactions imex curation quistgaard-2009-4 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. DIP original experiment: DIP-132939X Nature structural & molecular biology 2009 IMEx Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. Only protein-protein interactions imex curation quistgaard-2009-5 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. DIP original experiment: DIP-132938X Nature structural & molecular biology 2009 IMEx Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. Only protein-protein interactions imex curation quistgaard-2009-6 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. DIP original experiment: DIP-132936X Nature structural & molecular biology 2009 IMEx Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. Only protein-protein interactions imex curation nt Neurotensin peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ELYENKPRRPYIL sort_human Sortilin SORT1 Neurotensin receptor 3 Glycoprotein 95 100 kDa NT receptor protein protein human Homo sapiens Human MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRRSAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE bdnf_human Brain-derived neurotrophic factor Abrineurin BDNF protein protein human Homo sapiens Human MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR amrp_human Alpha-2-macroglobulin receptor-associated protein Low density lipoprotein receptor-related protein-associated protein 1 LRPAP1 A2MRAP protein protein human Homo sapiens Human MAPRRVRSFLRGLPALLLLLLFLGPWPAASHGGKYSREKNQPKPSPKRESGEEFRMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNVLLETLSRTEEIHENVISPSDLSDIKGSVLHSRHTELKEKLRSINQGLDRLRRVSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRISRARHNEL ngf_human Beta-nerve growth factor NGF NGFB protein protein human Homo sapiens Human MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA nt-sort1-1 3182285 N/A 3182291 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3182292 unspecified role unspecified role unspecified role unspecified role Region 1-758 Region 1-758 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster direct interaction direct interaction false false false sort1-bdnf-1 3182286 N/A 3182293 unspecified role unspecified role prey prey region 19-128 region 19-128 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3182292 unspecified role unspecified role bait bait Region 1-758 Region 1-758 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster direct interaction direct interaction false false false nt-sort1-2 3182287 N/A 3182292 unspecified role unspecified role unspecified role unspecified role Region 1-758 Region 1-758 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3182291 unspecified role unspecified role unspecified role unspecified role in vitro In vitro direct interaction direct interaction false false false sort1-lrpap1-1 3182288 N/A 3182294 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3182292 unspecified role unspecified role bait bait Region 1-758 Region 1-758 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster direct interaction direct interaction false false false sort1-sort1-1 3182289 N/A 3182292 unspecified role unspecified role prey prey Region 34-77 Region 34-77 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3182292 unspecified role unspecified role bait bait Region 1-758 Region 1-758 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q99523:p.Ser316Glu S316E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster direct interaction direct interaction false false false sort1-ngf-2 3182290 N/A 3182295 unspecified role unspecified role prey prey Region 19-121 Region 19-121 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3182292 unspecified role unspecified role bait bait Region 1-758 Region 1-758 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster direct interaction direct interaction false false false