DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chiswell-2008-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chiswell BP., Zhang R., Murphy JW., Boggon TJ., Calderwood DA. DIP original experiment: DIP-133593X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The structural basis of integrin-linked kinase-PINCH interactions. Chiswell BP., Zhang R., Murphy JW., Boggon TJ., Calderwood DA. Only protein-protein interactions imex curation chiswell-2008-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chiswell BP., Zhang R., Murphy JW., Boggon TJ., Calderwood DA. DIP original experiment: DIP-133595X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The structural basis of integrin-linked kinase-PINCH interactions. Chiswell BP., Zhang R., Murphy JW., Boggon TJ., Calderwood DA. Only protein-protein interactions imex curation chiswell-2008-3 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Chiswell BP., Zhang R., Murphy JW., Boggon TJ., Calderwood DA. DIP original experiment: DIP-133594X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The structural basis of integrin-linked kinase-PINCH interactions. Chiswell BP., Zhang R., Murphy JW., Boggon TJ., Calderwood DA. Only protein-protein interactions imex curation lims1_human LIM and senescent cell antigen-like-containing domain protein 1 LIMS1 Particularly interesting new Cys-His protein 1 Renal carcinoma antigen NY-REN-48 PINCH PINCH1 protein protein human Homo sapiens Human MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGELYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKNKFVEFDMKPVCKKCYEKFPLELKKRLKKLAETLGRK ilk_human Integrin-linked protein kinase ILK-1 ILK-2 59 kDa serine/threonine-protein kinase p59ILK ILK ILK1 ILK2 Beta-integrin-linked kinase protein protein human Homo sapiens Human MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK ilk-lims1-6 3181460 N/A 3181463 unspecified role unspecified role unspecified role unspecified role Region 6-68 Region 6-68 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3181464 unspecified role unspecified role unspecified role unspecified role Region 1-174 Region 1-174 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ilk-lims1-7 3181461 N/A 3181463 unspecified role unspecified role unspecified role unspecified role Region 6-68 Region 6-68 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3181464 unspecified role unspecified role unspecified role unspecified role Region 1-174 Region 1-174 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lims1-ilk-1 3181462 N/A 3181463 unspecified role unspecified role bait bait Region 6-68 Region 6-68 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P48059:p.Phe42Ala F42A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P48059:p.Asp62Ala D62A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P48059:p.Leu66Asp L66D mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3181464 unspecified role unspecified role prey prey Region 1-192 Region 1-192 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q13418:p.His99Asp H99D mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false