DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chipuk-2008-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chipuk JE., Fisher JC., Dillon CP., Kriwacki RW., Kuwana T., Green DR. DIP original experiment: DIP-133570X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mechanism of apoptosis induction by inhibition of the anti-apoptotic BCL-2 proteins. Chipuk JE., Fisher JC., Dillon CP., Kriwacki RW., Kuwana T., Green DR. Only protein-protein interactions imex curation chipuk-2008-2 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chipuk JE., Fisher JC., Dillon CP., Kriwacki RW., Kuwana T., Green DR. DIP original experiment: DIP-133571X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mechanism of apoptosis induction by inhibition of the anti-apoptotic BCL-2 proteins. Chipuk JE., Fisher JC., Dillon CP., Kriwacki RW., Kuwana T., Green DR. Only protein-protein interactions imex curation bid_human BH3-interacting domain death agonist p22 BID BID protein protein human Homo sapiens Human MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR bcl2-bid-2 3181431 N/A 3181433 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3181434 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false mcl1-bid-1 3181432 N/A 3181433 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3181435 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false