DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ long-2008-1 ecolx Escherichia coli 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Long Y., Zhao L., Niu B., Su J., Wu H., Chen Y., Zhang Q., Guo J., Zhuang C., Mei M., Xia J., Wang L., Wu H., Liu YG. DIP original experiment: DIP-260502X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Hybrid male sterility in rice controlled by interaction between divergent alleles of two adjacent genes. Long Y., Zhao L., Niu B., Su J., Wu H., Chen Y., Zhang Q., Guo J., Zhuang C., Mei M., Xia J., Wang L., Wu H., Liu YG. Only protein-protein interactions imex curation long-2008-2 allce Allium cepa (Onion) Onion bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Long Y., Zhao L., Niu B., Su J., Wu H., Chen Y., Zhang Q., Guo J., Zhuang C., Mei M., Xia J., Wang L., Wu H., Liu YG. DIP original experiment: DIP-260505X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Hybrid male sterility in rice controlled by interaction between divergent alleles of two adjacent genes. Long Y., Zhao L., Niu B., Su J., Wu H., Chen Y., Zhang Q., Guo J., Zhuang C., Mei M., Xia J., Wang L., Wu H., Liu YG. Only protein-protein interactions imex curation long-2008-3 ecolx Escherichia coli 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Long Y., Zhao L., Niu B., Su J., Wu H., Chen Y., Zhang Q., Guo J., Zhuang C., Mei M., Xia J., Wang L., Wu H., Liu YG. DIP original experiment: DIP-260503X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Hybrid male sterility in rice controlled by interaction between divergent alleles of two adjacent genes. Long Y., Zhao L., Niu B., Su J., Wu H., Chen Y., Zhang Q., Guo J., Zhuang C., Mei M., Xia J., Wang L., Wu H., Liu YG. Only protein-protein interactions imex curation long-2008-4 allce Allium cepa (Onion) Onion bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Long Y., Zhao L., Niu B., Su J., Wu H., Chen Y., Zhang Q., Guo J., Zhuang C., Mei M., Xia J., Wang L., Wu H., Liu YG. DIP original experiment: DIP-260504X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Hybrid male sterility in rice controlled by interaction between divergent alleles of two adjacent genes. Long Y., Zhao L., Niu B., Su J., Wu H., Chen Y., Zhang Q., Guo J., Zhuang C., Mei M., Xia J., Wang L., Wu H., Liu YG. Only protein-protein interactions imex curation b6rrx3_orysj SaM- OSNPB_010578700 Os01g0578700 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MAPPRPASPQSLPPVAATRSRGRPYEGWTLKELIGEVRRLRRAASSAPPRPAGVLDLDQGDARASDTVAPSPPSPCESQEQPHHLGKRLEDVLISLRDVAFQFIKIGRQDEVRKIVNVAHDIVVNFCNAIRAPEAFKLVAAAENVKPHLLKIDHDDNLLFLQFKAALEREQQVHNVNHEIAISLDKYTNCPLSGTEIAELTQPLRRLSWCCVKRPGI b6rrx2_orysi SaF+ protein protein orysi Oryza sativa subsp. indica Rice MEAVIAECRPKPLFTTGPFLSAVGGGGGGVDRISGLPDDLLFVILSKLPVRDAVATSALSPRWKSLWSSVPLRLDDAGLLHRRDGTRLGREGVAATVSAVLAAHPGPVPAASVGCCLSSDDQGYQLGGWLRALAAKGVRQLCLMGAPWSPRAALPSAVFSCSSLRRLFLGSVQCNWDLIPDHACFPELREIQICNALMKSQDLSLVLAVCPALETVEILASRNKIPTVRMSSHTIRNTLLWKSVAKEVNVLDTPCLSRVVLWQDLLLPHSRYNSKVTISRATKMRIFGYLDTGINTLVINETTVKVNTNISFKTLIPSVKVLGLSVHFGVRKEALMSISFLRCFPEVETLHITSKTDKASEAEQFSFWGKVDPVECVTSHLKKLVFHGMPWCPGNLEFLKFIVEGAYLLEKVLIVLPKGTYTSMHSVITKLKLAPLTSASWASHICKMEVVQSSQGTLSYQRASDHSVDDPLDYSL q9awx3_orysj SaF- OSNPB_010578500 Os01g0578500 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MEAVIAECRPKPLFTTGPFLSAVGGGGGGVDRISGLPDDLLFVILSKLPVRDAVATSALSPRWKSLWSSVPLRLDDAGLLHRRDGTRLGREGVAATVSAVLAAHPGPVPAASVGCCLSSDDQGYQLGGWLRALAAKGVRQLCLMGAPWSPRAALPSAVFSCSSLRRLFLGSVQCNWDLIPDHACFPELREIQICNALMKSQDLSLVLAVCPALETVEILASRNKIPTVRMSSHTIRNTLLWKSVAKEVNVLDTPCLSRVVLWQDLLLPHSRYNSKVTISRATKMRISGYLDTGINTLVINETTVKVNTNISFKTLIPSVKVLGLSVHFGVRKEALMSISFLRCFPEVETLHITSKTDKASEAEQFSFWGKVDPVECVTSHLKKLVFHGMPWCPGNLEFLKFIVEGAYLLEKVLIVLPKGTYTSMHSVITKLKLAPLTSASWASHICKMEVVQSSQGTLSYQRASDHSVDDPLDYSL sam_-saf+-1 3180626 N/A 3180630 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3180631 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false saf_-sam_-1 3180627 N/A 3180630 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false allce Allium cepa (Onion) Onion N/A 3180632 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false allce Allium cepa (Onion) Onion physical association physical association false false false sam_-saf_-1 3180628 N/A 3180630 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3180632 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false saf+-sam_-1 3180629 N/A 3180630 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false allce Allium cepa (Onion) Onion N/A 3180631 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false allce Allium cepa (Onion) Onion physical association physical association false false false