DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ verger-2008-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Verger D., Rose RJ., Paci E., Costakes G., Daviter T., Hultgren S., Remaut H., Ashcroft AE., Radford SE., Waksman G. DIP original experiment: DIP-113497X Structure (London, England : 1993) 2008 IMEx Structural determinants of polymerization reactivity of the P pilus adaptor subunit PapF. Verger D., Rose RJ., Paci E., Costakes G., Daviter T., Hultgren S., Remaut H., Ashcroft AE., Radford SE., Waksman G. Only protein-protein interactions imex curation verger-2008-2 ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Verger D., Rose RJ., Paci E., Costakes G., Daviter T., Hultgren S., Remaut H., Ashcroft AE., Radford SE., Waksman G. DIP original experiment: DIP-113498X Structure (London, England : 1993) 2008 IMEx Structural determinants of polymerization reactivity of the P pilus adaptor subunit PapF. Verger D., Rose RJ., Paci E., Costakes G., Daviter T., Hultgren S., Remaut H., Ashcroft AE., Radford SE., Waksman G. Only protein-protein interactions imex curation verger-2008-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Verger D., Rose RJ., Paci E., Costakes G., Daviter T., Hultgren S., Remaut H., Ashcroft AE., Radford SE., Waksman G. DIP original experiment: DIP-113499X Structure (London, England : 1993) 2008 IMEx Structural determinants of polymerization reactivity of the P pilus adaptor subunit PapF. Verger D., Rose RJ., Paci E., Costakes G., Daviter T., Hultgren S., Remaut H., Ashcroft AE., Radford SE., Waksman G. Only protein-protein interactions imex curation papf_ecolx Fimbrial adapter PapF papF protein protein ecolx Escherichia coli MIRLSLFISLLLTSVAVLADVQINIRGNVYIPPCTINNGQNIVVDFGNINPEHVDNSRGEVTKTISISCPYKSGSLWIKVTGNTMGGGQNNVLATNITHFGIALYQGKGMSTPLILGNGSGNGYGVTAGLDTARSTFTFTSVPFRNGSGILNGGDFQTTASMSMIYN papd_ecolx Chaperone protein PapD papD protein protein ecolx Escherichia coli MIRKKILMAAIPLFVISGADAAVSLDRTRAVFDGSEKSMTLDISNDNKQLPYLAQAWIENENQEKIITGPVIATPPVQRLEPGAKSMVRLSTTPDISKLPQDRESLFYFNLREIPPRSEKANVLQIALQTKIKLFYRPAAIKTRPNEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVKSANYNTPYLSYINDYGGRPVLSFICNGSRCSVKKEK papd-papf-3 3179909 N/A 3179912 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3179913 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false papd-papf-4 3179910 N/A 3179912 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3179913 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false papd-papf-5 3179911 N/A 3179912 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3179913 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false