DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kursula-2008-1 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Kursula I., Kursula P., Ganter M., Panjikar S., Matuschewski K., Schüler H. DIP original experiment: DIP-113486X Structure (London, England : 1993) 2008 IMEx Structural basis for parasite-specific functions of the divergent profilin of Plasmodium falciparum. Kursula I., Kursula P., Ganter M., Panjikar S., Matuschewski K., Schüler H. Only protein-protein interactions imex curation kursula-2008-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kursula I., Kursula P., Ganter M., Panjikar S., Matuschewski K., Schüler H. DIP original experiment: DIP-113483X Structure (London, England : 1993) 2008 IMEx Structural basis for parasite-specific functions of the divergent profilin of Plasmodium falciparum. Kursula I., Kursula P., Ganter M., Panjikar S., Matuschewski K., Schüler H. Only protein-protein interactions imex curation kursula-2008-3 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati weight by comassie molecular weight estimation by coomasie staining weight by comassie Kursula I., Kursula P., Ganter M., Panjikar S., Matuschewski K., Schüler H. DIP original experiment: DIP-113484X Structure (London, England : 1993) 2008 IMEx Structural basis for parasite-specific functions of the divergent profilin of Plasmodium falciparum. Kursula I., Kursula P., Ganter M., Panjikar S., Matuschewski K., Schüler H. Only protein-protein interactions imex curation kursula-2008-4 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Kursula I., Kursula P., Ganter M., Panjikar S., Matuschewski K., Schüler H. DIP original experiment: DIP-113485X Structure (London, England : 1993) 2008 IMEx Structural basis for parasite-specific functions of the divergent profilin of Plasmodium falciparum. Kursula I., Kursula P., Ganter M., Panjikar S., Matuschewski K., Schüler H. Only protein-protein interactions imex curation prof1_human Profilin-1 Profilin I PFN1 Epididymis tissue protein Li 184a protein protein human Homo sapiens Human MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF octaproline Octaproline peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) PPPPPPPP prof_plaf7 Profilin Pfn PFI1565w protein protein plaf7 Plasmodium falciparum (isolate 3D7) MAEEYSWDSYLNDRLLATNQVSGAGLASEEDGVVYACVAQGEESDPNFDKWSLFYKEDYDIEVEDENGTKTTKTINEGQTILVVFNEGYAPDGVWLGGTKYQFINIERDLEFEGYNFDVATCAKLKGGLHLVKVPGGNILVVLYDEEKEQDRGNSKIAALTFAKELAESSQ actb-pfn1-1 3179837 N/A 3179841 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3179842 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false octaproline-pfn-1 3179838 N/A 3179843 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3179844 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false actb-4 3179839 N/A 3179842 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false actb-pfn-1 3179840 N/A 3179844 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3179842 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false