DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ seo-2008-6 in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Seo EJ., Liu F., Kawagishi-Kobayashi M., Ung TL., Cao C., Dar AC., Sicheri F., Dever TE. DIP original experiment: DIP-260478X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Protein kinase PKR mutants resistant to the poxvirus pseudosubstrate K3L protein. Seo EJ., Liu F., Kawagishi-Kobayashi M., Ung TL., Cao C., Dar AC., Sicheri F., Dever TE. Only protein-protein interactions imex curation seo-2008-7 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Seo EJ., Liu F., Kawagishi-Kobayashi M., Ung TL., Cao C., Dar AC., Sicheri F., Dever TE. DIP original experiment: DIP-260479X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Protein kinase PKR mutants resistant to the poxvirus pseudosubstrate K3L protein. Seo EJ., Liu F., Kawagishi-Kobayashi M., Ung TL., Cao C., Dar AC., Sicheri F., Dever TE. Only protein-protein interactions imex curation if2a_human Eukaryotic translation initiation factor 2 subunit 1 EIF2S1 EIF2A Eukaryotic translation initiation factor 2 subunit alpha protein protein human Homo sapiens Human MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSINKLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNINRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEVDGDDDAEEMEAKAED e2ak2_human Interferon-induced, double-stranded RNA-activated protein kinase Interferon-inducible RNA-dependent protein kinase Eukaryotic translation initiation factor 2-alpha kinase 2 Protein kinase RNA-activated p68 kinase P1/eIF-2A protein kinase EIF2AK2 PKR PRKR Tyrosine-protein kinase EIF2AK2 protein protein human Homo sapiens Human MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSGSFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAKRSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC k3_vaccc Protein K3 K3L protein protein vaccc Vaccinia virus (strain Copenhagen) (VACV) VACV MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHSEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ Plays an integral role in the resistance of the virus to interferon. May bind competitively to the P1 kinase to block eIF-2-alpha phosphorylation mint eif2ak2-eif2s1-3 3179603 N/A 3179605 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 1-200 Region 1-200 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3179606 enzyme enzyme unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast phosphorylation phosphorylation reaction phosphorylation false false false k3_vaccc-eif2ak2-1 3179604 N/A 3179607 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3179606 unspecified role unspecified role prey prey P19525:p.Asp486Val D486V mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Region 258-551 Region 258-551 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false