DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ gavathiotis-2008-1 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Gavathiotis E., Suzuki M., Davis ML., Pitter K., Bird GH., Katz SG., Tu HC., Kim H., Cheng EH., Tjandra N., Walensky LD. DIP original experiment: DIP-250187X Nature 2008 IMEx BAX activation is initiated at a novel interaction site. Gavathiotis E., Suzuki M., Davis ML., Pitter K., Bird GH., Katz SG., Tu HC., Kim H., Cheng EH., Tjandra N., Walensky LD. Only protein-protein interactions imex curation gavathiotis-2008-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Gavathiotis E., Suzuki M., Davis ML., Pitter K., Bird GH., Katz SG., Tu HC., Kim H., Cheng EH., Tjandra N., Walensky LD. DIP original experiment: DIP-250188X Nature 2008 IMEx BAX activation is initiated at a novel interaction site. Gavathiotis E., Suzuki M., Davis ML., Pitter K., Bird GH., Katz SG., Tu HC., Kim H., Cheng EH., Tjandra N., Walensky LD. Only protein-protein interactions imex curation bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG b2l11_human Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH bax-bcl2l11-3 3179098 N/A 3179100 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3179101 unspecified role unspecified role unspecified role unspecified role Region 145-164 Region 145-164 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false bax-bcl2l11-4 3179099 N/A 3179100 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3179101 unspecified role unspecified role unspecified role unspecified role Region 145-164 Region 145-164 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false