DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kukimoto_niino-2008-1 chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kukimoto-Niino M., Sakamoto A., Kanno E., Hanawa-Suetsugu K., Terada T., Shirouzu M., Fukuda M., Yokoyama S. DIP original experiment: DIP-113222X Structure (London, England : 1993) 2008 IMEx Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases. Kukimoto-Niino M., Sakamoto A., Kanno E., Hanawa-Suetsugu K., Terada T., Shirouzu M., Fukuda M., Yokoyama S. Only protein-protein interactions imex curation kukimoto_niino-2008-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Kukimoto-Niino M., Sakamoto A., Kanno E., Hanawa-Suetsugu K., Terada T., Shirouzu M., Fukuda M., Yokoyama S. DIP original experiment: DIP-113220X Structure (London, England : 1993) 2008 IMEx Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases. Kukimoto-Niino M., Sakamoto A., Kanno E., Hanawa-Suetsugu K., Terada T., Shirouzu M., Fukuda M., Yokoyama S. Only protein-protein interactions imex curation kukimoto_niino-2008-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kukimoto-Niino M., Sakamoto A., Kanno E., Hanawa-Suetsugu K., Terada T., Shirouzu M., Fukuda M., Yokoyama S. DIP original experiment: DIP-113221X Structure (London, England : 1993) 2008 IMEx Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases. Kukimoto-Niino M., Sakamoto A., Kanno E., Hanawa-Suetsugu K., Terada T., Shirouzu M., Fukuda M., Yokoyama S. Only protein-protein interactions imex curation kukimoto_niino-2008-4 chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kukimoto-Niino M., Sakamoto A., Kanno E., Hanawa-Suetsugu K., Terada T., Shirouzu M., Fukuda M., Yokoyama S. DIP original experiment: DIP-113223X Structure (London, England : 1993) 2008 IMEx Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases. Kukimoto-Niino M., Sakamoto A., Kanno E., Hanawa-Suetsugu K., Terada T., Shirouzu M., Fukuda M., Yokoyama S. Only protein-protein interactions imex curation rb27a_mouse Ras-related protein Rab-27A Rab27a protein protein mouse Mus musculus Mouse MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRANGPDGAVGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGIPYFETSAANGTNISHAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHTSADQLSEEKEKGLCGC melph_mouse Melanophilin Mlph Ln Slac2a Exophilin-3 Leaden protein Synaptotagmin-like protein 2a Slp homolog lacking C2 domains a protein protein mouse Mus musculus Mouse MGKRLDLSTLTDEEAEHVWAVVQRDFDLRRREEERLQGLKGKIQKESSKRELLSDTAHLNETHCARCLQPYRLLLNSRRQCLECSLFVCKSCSHAHPEEQGWLCDPCHLARVVKIGSLEWYYQHVRARFKRFGSAKVIRSLCGRLQGGGGSEPSLEEGNGDSEQTDEDGDLDTEARDQPLNSKKKKRLLSFRDVDFEEDSDHLVQPCSQTLGLSSVPESAHSLQSLSGEPYSEDTTSLEPEGLEETGARALGCRPSPEVQPCSPLPSGEDAHAELDSPAASCKSAFGTTAMPGTDDVRGKHLPSQYLADVDTSDEDSIQGPRAASQHSKRRARTVPETQILELNKRMSAVEHLLVHLENTVLPPSAQEPTVETHPSADTEEETLRRRLEELTSNISGSSTSSEDETKPDGTFLGGSPKVCTDTGHMETQERNPRSPGNPARPTKSTDEELSEMEDRVAMTASEVQQAESEISDIESRIAALRAAGLTVKPSGKPRRKSGIPIFLPRVTEKLDRIPKTPPADPDDQAKMPKATTAVPSLLRRKYSPSSQGVDSGSFDRKSVYRGSLTQRNPNGRRGTARHIFAKPVMAQQP rb27b_mouse Ras-related protein Rab-27B Rab27b protein protein mouse Mus musculus Mouse MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDTQGADGASGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVEKTQVPDTVNGGNSGKLDGEKPAEKKCAC rab3a_mouse Ras-related protein Rab-3A Rab3a protein protein mouse Mus musculus Mouse MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC mlph-rab27a-6 3178768 N/A 3178772 unspecified role unspecified role prey prey Q9ERI2:p.Tyr6Phe Y6F mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9ERI2:p.[Tyr6Phe;Leu84Ile;Phe88Tyr;Asp91Gly] Y6F/L84I/F88Y/D91G mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey N/A 3178773 unspecified role unspecified role bait bait Region 1-146 Region 1-146 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false T7-tag T7-tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association false false false mlph-rab27b-1 3178769 N/A 3178773 unspecified role unspecified role unspecified role unspecified role Region 1-146 Region 1-146 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3178774 unspecified role unspecified role unspecified role unspecified role Region 1-201 Region 1-201 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mlph-rab27b-2 3178770 N/A 3178773 unspecified role unspecified role unspecified role unspecified role Region 1-146 Region 1-146 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3178774 unspecified role unspecified role unspecified role unspecified role Region 1-201 Region 1-201 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mlph-rab3a-1 3178771 N/A 3178775 unspecified role unspecified role prey prey P63011:p.Phe19Tyr F19Y mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P63011:p.Gly94Asp G94D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P63011:p.[Phe19Tyr;Gly94Asp] F19Y/G94D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P63011:p.[Ile87Leu;Tyr91Phe;Gly94Asp] I87L/Y91F/G94D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey N/A 3178773 unspecified role unspecified role bait bait Region 1-146 Region 1-146 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false T7-tag T7-tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association false false false