DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chavas-2008-1 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. DIP original experiment: DIP-113212X Structure (London, England : 1993) 2008 IMEx Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. Only protein-protein interactions imex curation chavas-2008-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. DIP original experiment: DIP-113210X Structure (London, England : 1993) 2008 IMEx Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. Only protein-protein interactions imex curation chavas-2008-3 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. DIP original experiment: DIP-113217X Structure (London, England : 1993) 2008 IMEx Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. Only protein-protein interactions imex curation chavas-2008-4 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. DIP original experiment: DIP-113215X Structure (London, England : 1993) 2008 IMEx Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. Only protein-protein interactions imex curation chavas-2008-5 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. DIP original experiment: DIP-113218X Structure (London, England : 1993) 2008 IMEx Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. Only protein-protein interactions imex curation chavas-2008-6 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. DIP original experiment: DIP-113214X Structure (London, England : 1993) 2008 IMEx Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. Only protein-protein interactions imex curation chavas-2008-7 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. DIP original experiment: DIP-113216X Structure (London, England : 1993) 2008 IMEx Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. Only protein-protein interactions imex curation chavas-2008-8 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. DIP original experiment: DIP-113211X Structure (London, England : 1993) 2008 IMEx Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. Only protein-protein interactions imex curation chavas-2008-9 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. DIP original experiment: DIP-113213X Structure (London, England : 1993) 2008 IMEx Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. Only protein-protein interactions imex curation chavas-2008-10 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. DIP original experiment: DIP-113219X Structure (London, England : 1993) 2008 IMEx Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. Only protein-protein interactions imex curation sytl2_human Synaptotagmin-like protein 2 KIAA1597 SGA72M SLP2 SLP2A Breast cancer-associated antigen SGA-72M Exophilin-4 SYTL2 protein protein human Homo sapiens Human MIDLSFLTEEEQEAIMKVLQRDAALKRAEEERVRHLPEKIKDDQQLKNMSGQWFYEAKAKRHRDKIHGADIIRASMRKKRPQIAAEQSKDRENGAKESWVNNVNKDAFLPPELAGVVEEPEEDAAPASPSSSVVNPASSVIDMSQENTRKPNVSPEKRKNPFNSSKLPEGHSSQQTKNEQSKNGRTGLFQTSKEDELSESKEKSTVADTSIQKLEKSKQTLPGLSNGSQIKAPIPKARKMIYKSTDLNKDDNQSFPRQRTDSLKARGAPRGILKRNSSSSSTDSETLRYNHNFEPKSKIVSPGLTIHERISEKEHSLEDNSSPNSLEPLKHVRFSAVKDELPQSPGLIHGREVGEFSVLESDRLKNGMEDAGDTEEFQSDPKPSQYRKPSLFHQSTSSPYVSKSETHQPMTSGSFPINGLHSHSEVLTARPQSMENSPTINEPKDKSSELTRLESVLPRSPADELSHCVEPEPSQVPGGSSRDRQQGSEEEPSPVLKTLERSAARKMPSKSLEDISSDSSNQAKVDNQPEELVRSAEDVSTVPTQPDNPFSHPDKLKRMSKSVPAFLQDESDDRETDTASESSYQLSRHKKSPSSLTNLSSSSGMTSLSSVSGSVMSVYSGDFGNLEVKGNIQFAIEYVESLKELHVFVAQCKDLAAADVKKQRSDPYVKAYLLPDKGKMGKKKTLVVKKTLNPVYNEILRYKIEKQILKTQKLNLSIWHRDTFKRNSFLGEVELDLETWDWDNKQNKQLRWYPLKRKTAPVALEAENRGEMKLALQYVPEPVPGKKLPTTGEVHIWVKECLDLPLLRGSHLNSFVKCTILPDTSRKSRQKTRAVGKTTNPIFNHTMVYDGFRPEDLMEACVELTVWDHYKLTNQFLGGLRIGFGTGKSYGTEVDWMDSTSEEVALWEKMVNSPNTWIEATLPLRMLLIAKISK rb27a_mouse Ras-related protein Rab-27A Rab27a protein protein mouse Mus musculus Mouse MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRANGPDGAVGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGIPYFETSAANGTNISHAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHTSADQLSEEKEKGLCGC melph_human Melanophilin MLPH SLAC2A Exophilin-3 Synaptotagmin-like protein 2a Slp homolog lacking C2 domains a protein protein human Homo sapiens Human MGKKLDLSKLTDEEAQHVLEVVQRDFDLRRKEEERLEALKGKIKKESSKRELLSDTAHLNETHCARCLQPYQLLVNSKRQCLECGLFTCKSCGRVHPEEQGWICDPCHLARVVKIGSLEWYYEHVKARFKRFGSAKVIRSLHGRLQGGAGPELISEERSGDSDQTDEDGEPGSEAQAQAQPFGSKKKRLLSVHDFDFEGDSDDSTQPQGHSLHLSSVPEARDSPQSLTDESCSEKAAPHKAEGLEEADTGASGCHSHPEEQPTSISPSRHGALAELCPPGGSHRMALGTAAALGSNVIRNEQLPLQYLADVDTSDEESIRAHVMASHHSKRRGRASSESQIFELNKHISAVECLLTYLENTVVPPLAKGLGAGVRTEADVEEEALRRKLEELTSNVSDQETSSEEEEAKDEKAEPNRDKSVGPLPQADPEVGTAAHQTNRQEKSPQDPGDPVQYNRTTDEELSELEDRVAVTASEVQQAESEVSDIESRIAALRAAGLTVKPSGKPRRKSNLPIFLPRVAGKLGKRPEDPNADPSSEAKAMAVPYLLRRKFSNSLKSQGKDDDSFDRKSVYRGSLTQRNPNARKGMASHTFAKPVVAHQS mint Rab effector protein involved in melanosome transport. Serves as link between melanosome-bound RAB27A and the motor protein MYO5A Defects in MLPH are a cause of Griscelli syndrome type-3 (GS3) [MIM:609227]. GS3 is a rare autosomal recessive disorder characterized by pigmentary dilution of the skin and hair, the presence of large clumps of pigment in hair shafts, and an accumulation of melanosomes in melanocytes, without other clinical manifestations rb27b_mouse Ras-related protein Rab-27B Rab27b protein protein mouse Mus musculus Mouse MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDTQGADGASGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVEKTQVPDTVNGGNSGKLDGEKPAEKKCAC q9r0q1-1 Synaptotagmin-like protein 4 Sytl4 Slp4 Granuphilin-a Exophilin-2 Granuphilin protein protein mouse Mus musculus Mouse MSEILDLSFLSEMERDLILGVLQRDEELRKADEKRIRRLKNELLEIKRKGAKRGSQHYSDRTCARCQEGLGRLIPKSSTCVGCNHLVCRECRVLESNGSWRCKVCSKEIELKKATGDWFYDQKVNRFDYRTGSEIIRMSLRQKPAVNKRETAGQSLLQQTQMGDIWPGRRIIQEQQQREQSVLFEVPKTRSGKSALEAESESLDSYTADSDSTSRRDSLDKSGLFPEWKKMSAPKSQVEKEIPPGNQNAVCGDEGDMVFKKNTKKVLRPSEYTKSVIDLRPEDVAQESGILGDRSKSVPGLSVDMEEEEEEEEDIDHLVKLHRQKLARGSMQSGSSMSTLGSIMSIYSEAGDFGNISVTGKIAFSLKFEQKTQTLVIHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETFRYEISESLLAQRTLQFSVWHHGRFGRNTFLGEAEVHMDSWKLDKKLDHCLPLHGKISTESSPGLPAHKGELVVSLKYIPASKLPVGGDRKKSKGGEGGELQVWIKEAKNLTAAKSGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLSPHYNHTFVYNGVRLEDLQHMCLELTVWDREPLASNDFLGGVRLGVGTGISNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQLRSSMVKQKLGV sytl2-rab27a-2 3178686 N/A 3178696 unspecified role unspecified role bait bait Region 10-62 Region 10-62 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3178697 unspecified role unspecified role prey prey Region 1-193 Region 1-193 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q9ERI2:p.[Cys123Ser;Cys188Ser] C123S/C188S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rab27a-sytl2-1 3178687 N/A 3178696 unspecified role unspecified role unspecified role unspecified role Region 10-62 Region 10-62 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3178697 unspecified role unspecified role unspecified role unspecified role Region 1-193 Region 1-193 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mlph-rab27b-3 3178688 N/A 3178698 unspecified role unspecified role bait bait Region 13-129 Region 13-129 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3178699 unspecified role unspecified role prey prey Q99P58:p.Cys188Ser C188S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q99P58:p.[Cys123Ser;Cys188Ser] C123S/C188S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sytl4-rab27b-1 3178689 N/A 3178699 unspecified role unspecified role prey prey Q99P58:p.Cys123Ser C123S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q99P58:p.Cys188Ser C188S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q99P58:p.[Cys123Ser;Cys188Ser] C123S/C188S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3178700 unspecified role unspecified role bait bait Region 12-128 Region 12-128 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false rab27a-sytl4-3 3178690 N/A 3178700 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3178697 unspecified role unspecified role bait bait Region 57-66 Region 57-66 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false sytl4-rab27a-2 3178691 N/A 3178700 unspecified role unspecified role bait bait Region 12-128 Region 12-128 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3178697 unspecified role unspecified role prey prey Region 1-193 Region 1-193 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q9ERI2:p.[Cys123Ser;Cys188Ser] C123S/C188S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9ERI2:p.Cys123Ser C123S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9ERI2:p.Cys188Ser C188S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mlph-rab27a-5 3178692 N/A 3178698 unspecified role unspecified role bait bait Region 13-129 Region 13-129 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3178697 unspecified role unspecified role prey prey Q9ERI2:p.Cys188Ser C188S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9ERI2:p.[Cys123Ser;Cys188Ser] C123S/C188S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Region 1-193 Region 1-193 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rab27a-sytl2-2 3178693 N/A 3178696 unspecified role unspecified role unspecified role unspecified role Region 10-62 Region 10-62 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3178697 unspecified role unspecified role unspecified role unspecified role Region 1-193 Region 1-193 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sytl2-rab27b-1 3178694 N/A 3178699 unspecified role unspecified role prey prey Q99P58:p.[Cys123Ser;Cys188Ser] C123S/C188S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3178696 unspecified role unspecified role bait bait Region 10-62 Region 10-62 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false rab27a-sytl2-3 3178695 N/A 3178696 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 3178697 unspecified role unspecified role bait bait Region 57-66 Region 57-66 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false