IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ simhadri-2007-1 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Simhadri VR., Reiners KS., Hansen HP., Topolar D., Simhadri VL., Nohroudi K., Kufer TA., Engert A., Pogge von Strandmann E. Primary immature dendritic cells (iDCs) were differentiated from adherent peripheral blood monocytes in the presence of IL-4 and GM-CSF for 5 days. The source of BAT3 was concentrated supernatant obtained from heat shock treated iDCs. elke.pogge@uk-koeln.de, venkatsimhadri@googlemail.com PloS one 2007 imex curation Only protein-protein interactions simhadri-2007-2 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Simhadri VR., Reiners KS., Hansen HP., Topolar D., Simhadri VL., Nohroudi K., Kufer TA., Engert A., Pogge von Strandmann E. elke.pogge@uk-koeln.de, venkatsimhadri@googlemail.com PloS one 2007 imex curation Only protein-protein interactions bag6_human Large proline-rich protein BAG6 BAT3 G3 HLA-B-associated transcript 3 Protein G3 BCL2-associated athanogene 6 BAG6 BAG family molecular chaperone regulator 6 Protein Scythe protein protein human Homo sapiens Human MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGPGASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLLSRMETLPYLQCRGGPQPQHSQPPPQPPAVTPEPVALSSQTSEPVESEAPPREPMEAEEVEERAPAQNPELTPGPAPAGPTPAPETNAPNHPSPAEYVEVLQELQRLESRLQPFLQRYYEVLGAAATTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACTPPRHLHVVRPMSHYTTPMVLQQAAIPIQINVGTTVTMTGNGTRPPPTPNAEAPPPGPGQASSVAPSSTNVESSAEGAPPPGPAPPPATSHPRVIRISHQSVEPVVMMHMNIQDSGTQPGGVPSAPTGPLGPPGHGQTLGQQVPGFPTAPTRVVIARPTPPQARPSHPGGPPVSGTLQGAGLGTNASLAQMVSGLVGQLLMQPVLVAQGTPGMAPPPAPATASASAGTTNTATTAGPAPGGPAQPPPTPQPSMADLQFSQLLGNLLGPAGPGAGGSGVASPTITVAMPGVPAFLQGMTDFLQATQTAPPPPPPPPPPPPAPEQQTMPPPGSPSGGAGSPGGLGLESLSPEFFTSVVQGVLSSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGALGFFGALLSLLCQNFSMVDVVMLLHGHFQPLQRLQPQLRSFFHQHYLGGQEPTPSNIRMATHTLITGLEEYVRESFSLVQVQPGVDIIRTNLEFLQEQFNSIAAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIRRMSRGVNPSLVSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQPLPEEPMEVQGAERASPEPQRENASPAPGTTAEEAMSRGPPPAPEGGSRDEQDGASAETEPWAAAVPPEWVPIIQQDIQSQRKVKPQPPLSDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFPNAQRAFADDP nctr3_human Natural cytotoxicity triggering receptor 3 NCR3 1C7 LY117 Activating natural killer receptor p30 Natural killer cell p30-related protein protein protein human Homo sapiens Human MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG hspa1a_hspa1b_human-1 HSPA1A_HSPA1B_human molecule set molecule set human Homo sapiens Human P0DMV8,P0DMV9 ncr3-bag6-4 2969610 N/A 2969612 unspecified role unspecified role prey prey human-mddc Human Monocyte-derived dendritic cell monocyte-derived_dendritic_cell Monocyte-derived dendritic cell (MDDC) N/A 2969613 unspecified role unspecified role bait bait human IgG1 kappa signal sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecd sufficient to bind sufficient binding region sufficient to bind range range range range false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false Fig 1B bag6-hspa1a_hspa1b_human-1 2969611 N/A 2969614 unspecified role unspecified role bait bait N/A 2969612 unspecified role unspecified role prey prey physical association physical association false false false 3F