DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ vey-2008-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Vey JL., Yang J., Li M., Broderick WE., Broderick JB., Drennan CL. DIP original experiment: DIP-133409X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Structural basis for glycyl radical formation by pyruvate formate-lyase activating enzyme. Vey JL., Yang J., Li M., Broderick WE., Broderick JB., Drennan CL. Only protein-protein interactions imex curation peptide-4 Peptide substrate peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) RVSGYAV pfla_ecoli Pyruvate formate-lyase 1-activating enzyme pflA act b0902 JW0885 PFL-activating enzyme 1 Formate-C-acetyltransferase-activating enzyme 1 protein protein ecoli Escherichia coli (strain K12) MSVIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHGGKEVTVEDLMKEVVTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDPVIDELLEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAKYLANKNVKVWIRYVVVPGWSDDDDSAHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDGVKPPKKETMERVKGILEQYGHKVMF peptide-pfla-1 3178397 N/A 3178398 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3178399 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false