DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ banse-2008-1 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Banse AV., Chastanet A., Rahn-Lee L., Hobbs EC., Losick R. DIP original experiment: DIP-113427X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Parallel pathways of repression and antirepression governing the transition to stationary phase in Bacillus subtilis. Banse AV., Chastanet A., Rahn-Lee L., Hobbs EC., Losick R. Only protein-protein interactions imex curation banse-2008-2 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Banse AV., Chastanet A., Rahn-Lee L., Hobbs EC., Losick R. DIP original experiment: DIP-113428X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Parallel pathways of repression and antirepression governing the transition to stationary phase in Bacillus subtilis. Banse AV., Chastanet A., Rahn-Lee L., Hobbs EC., Losick R. Only protein-protein interactions imex curation abrb_bacsu Transition state regulatory protein AbrB BSU00370 cpsX abrB protein protein bacsu Bacillus subtilis MFMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTGEVSDDNLKLAGGKLVLSKEGAEQIISEIQNQLQNLK 6A964557F5590CFE ykzf_bacsu Uncharacterized protein YkzF ykzF BSU14120 protein protein bacsu Bacillus subtilis MRMSLIGERFTEEEQKLLLNILINHEYAIELLSSEINDIETGTKNVDGTTYKKLVTLYDRFRFEN C3EF0D0CB8AE022F abba-abrb-1 3178306 N/A 3178308 unspecified role unspecified role prey prey baciu Bacillus subtilis N/A 3178309 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false abrb-abba-1 3178307 N/A 3178308 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3178309 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false