DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhou-2008-72 rhofa Rhodococcus fascians molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhou Z., Hashimoto Y., Shiraki K., Kobayashi M. DIP original experiment: DIP-113397X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Discovery of posttranslational maturation by self-subunit swapping. Zhou Z., Hashimoto Y., Shiraki K., Kobayashi M. Only protein-protein interactions imex curation zhou-2008-73 rhofa Rhodococcus fascians solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Zhou Z., Hashimoto Y., Shiraki K., Kobayashi M. DIP original experiment: DIP-113400X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Discovery of posttranslational maturation by self-subunit swapping. Zhou Z., Hashimoto Y., Shiraki K., Kobayashi M. Only protein-protein interactions imex curation zhou-2008-74 rhofa Rhodococcus fascians molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhou Z., Hashimoto Y., Shiraki K., Kobayashi M. DIP original experiment: DIP-113398X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Discovery of posttranslational maturation by self-subunit swapping. Zhou Z., Hashimoto Y., Shiraki K., Kobayashi M. Only protein-protein interactions imex curation zhou-2008-75 rhofa Rhodococcus fascians solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Zhou Z., Hashimoto Y., Shiraki K., Kobayashi M. DIP original experiment: DIP-113399X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Discovery of posttranslational maturation by self-subunit swapping. Zhou Z., Hashimoto Y., Shiraki K., Kobayashi M. Only protein-protein interactions imex curation nhb2_rhorh Low-molecular weight cobalt-containing nitrile hydratase subunit beta protein protein rhorh Rhodococcus rhodochrous MDGIHDLGGRAGLGPIKPESDEPVFHSDWERSVLTMFPAMALAGAFNLDQFRGAMEQIPPHDYLTSQYYEHWMHAMIHHGIEAGIFDSDELDRRTQYYMDHPDDTTPTRQDPQLVETISQLITHGADYRRPTDTEAAFAVGDKVIVRSDASPNTHTRRAGYVRGRVGEVVATHGAYVFPDTNALGAGESPEHLYTVRFSATELWGEPAAPNVVNHIDVFEPYLLPA nha2_rhorh Low-molecular weight cobalt-containing nitrile hydratase subunit alpha protein protein rhorh Rhodococcus rhodochrous MTAHNPVQGTLPRSNEEIAARVKAMEAILVDKGLISTDAIDHMSSVYENEVGPQLGAKIVARAWVDPEFKQRLLTDATSACREMGVGGMQGEEMVVLENTGTVHNMVVCTLCSCYPWPVLGLPPNWYKYPAYRARAVRDPRGVLAEFGYTPDPDVEIRIWDSSAELRYWVLPQRPAGTENFTEEQLADLVTRDSLIGVSVPTTPSKA p96453_rhorh nhlE protein protein rhorh Rhodococcus rhodochrous MPRLNEQPHPGLEANLGDLVQNLPFNERIPRRSGEVAFDQAWEIRAFSIATALHGQGRFEWDEFQSRLIESIKQWEAEHATTEQWSYYERWMLALEELLHDKGFVAGEELAHRTEQVLATPAGAHHQHAVRDPIAVHAIGTRTTDSDG nha2_rhorh-nhb2_rhorh-1 3177745 N/A 3177749 unspecified role unspecified role unspecified role unspecified role rhofa Rhodococcus fascians N/A 3177750 unspecified role unspecified role unspecified role unspecified role rhofa Rhodococcus fascians direct interaction direct interaction false false false nha2_rhorh-nhle-1 3177746 N/A 3177751 unspecified role unspecified role unspecified role unspecified role rhofa Rhodococcus fascians N/A 3177750 unspecified role unspecified role unspecified role unspecified role rhofa Rhodococcus fascians direct interaction direct interaction false false false nha2_rhorh-nhle-2 3177747 N/A 3177751 unspecified role unspecified role unspecified role unspecified role rhofa Rhodococcus fascians N/A 3177750 unspecified role unspecified role unspecified role unspecified role rhofa Rhodococcus fascians direct interaction direct interaction false false false nha2_rhorh-nhb2_rhorh-2 3177748 N/A 3177749 unspecified role unspecified role unspecified role unspecified role rhofa Rhodococcus fascians N/A 3177750 unspecified role unspecified role unspecified role unspecified role rhofa Rhodococcus fascians direct interaction direct interaction false false false