DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ srivastava-2008-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Srivastava S., Zhdanova O., Di L., Li Z., Albaqumi M., Wulff H., Skolnik EY. DIP original experiment: DIP-133378X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Protein histidine phosphatase 1 negatively regulates CD4 T cells by inhibiting the K+ channel KCa3.1. Srivastava S., Zhdanova O., Di L., Li Z., Albaqumi M., Wulff H., Skolnik EY. Only protein-protein interactions imex curation srivastava-2008-2 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Srivastava S., Zhdanova O., Di L., Li Z., Albaqumi M., Wulff H., Skolnik EY. DIP original experiment: DIP-133379X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Protein histidine phosphatase 1 negatively regulates CD4 T cells by inhibiting the K+ channel KCa3.1. Srivastava S., Zhdanova O., Di L., Li Z., Albaqumi M., Wulff H., Skolnik EY. Only protein-protein interactions imex curation php14_human 14 kDa phosphohistidine phosphatase Phosphohistidine phosphatase 1 Protein janus-A homolog PHPT1 PHP14 CGI-202 HSPC141 Protein histidine phosphatase protein protein human Homo sapiens Human MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY kcnn4_human Intermediate conductance calcium-activated potassium channel protein 4 KCNN4 IK1 IKCA1 KCA4 SK4 KCa4 KCa3.1 IKCa1 Putative Gardos channel protein protein human Homo sapiens Human MGGDLVLGLGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFLVKCTISISTFLLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPAPVRGPPCVQDLGAPLTSPQPWPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYRSIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDTLWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHNFMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRKLREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLPEPSQQSK kcnn4-phpt1-1 3177706 N/A 3177708 unspecified role unspecified role prey prey GFP tag GFP tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3177709 unspecified role unspecified role bait bait Flag tag Flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false phpt1-kcnn4-1 3177707 N/A 3177708 unspecified role unspecified role bait bait GFP tag GFP tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3177709 unspecified role unspecified role prey prey Flag tag Flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false