DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ krick-2008-1 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Krick S., Shi S., Ju W., Faul C., Tsai SY., Mundel P., Böttinger EP. DIP original experiment: DIP-113390X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mpv17l protects against mitochondrial oxidative stress and apoptosis by activation of Omi/HtrA2 protease. Krick S., Shi S., Ju W., Faul C., Tsai SY., Mundel P., Böttinger EP. Only protein-protein interactions imex curation krick-2008-2 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Krick S., Shi S., Ju W., Faul C., Tsai SY., Mundel P., Böttinger EP. DIP original experiment: DIP-113395X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mpv17l protects against mitochondrial oxidative stress and apoptosis by activation of Omi/HtrA2 protease. Krick S., Shi S., Ju W., Faul C., Tsai SY., Mundel P., Böttinger EP. Only protein-protein interactions imex curation krick-2008-3 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Krick S., Shi S., Ju W., Faul C., Tsai SY., Mundel P., Böttinger EP. DIP original experiment: DIP-113393X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mpv17l protects against mitochondrial oxidative stress and apoptosis by activation of Omi/HtrA2 protease. Krick S., Shi S., Ju W., Faul C., Tsai SY., Mundel P., Böttinger EP. Only protein-protein interactions imex curation krick-2008-4 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Krick S., Shi S., Ju W., Faul C., Tsai SY., Mundel P., Böttinger EP. DIP original experiment: DIP-113391X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mpv17l protects against mitochondrial oxidative stress and apoptosis by activation of Omi/HtrA2 protease. Krick S., Shi S., Ju W., Faul C., Tsai SY., Mundel P., Böttinger EP. Only protein-protein interactions imex curation krick-2008-5 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Krick S., Shi S., Ju W., Faul C., Tsai SY., Mundel P., Böttinger EP. DIP original experiment: DIP-113396X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mpv17l protects against mitochondrial oxidative stress and apoptosis by activation of Omi/HtrA2 protease. Krick S., Shi S., Ju W., Faul C., Tsai SY., Mundel P., Böttinger EP. Only protein-protein interactions imex curation krick-2008-6 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Krick S., Shi S., Ju W., Faul C., Tsai SY., Mundel P., Böttinger EP. DIP original experiment: DIP-113394X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mpv17l protects against mitochondrial oxidative stress and apoptosis by activation of Omi/HtrA2 protease. Krick S., Shi S., Ju W., Faul C., Tsai SY., Mundel P., Böttinger EP. Only protein-protein interactions imex curation krick-2008-7 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Krick S., Shi S., Ju W., Faul C., Tsai SY., Mundel P., Böttinger EP. DIP original experiment: DIP-113392X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mpv17l protects against mitochondrial oxidative stress and apoptosis by activation of Omi/HtrA2 protease. Krick S., Shi S., Ju W., Faul C., Tsai SY., Mundel P., Böttinger EP. Only protein-protein interactions imex curation htra2_mouse Serine protease HTRA2, mitochondrial Htra2 Omi Prss25 High temperature requirement protein A2 Omi stress-regulated endoprotease Serine proteinase OMI Serine protease 25 protein protein mouse Mus musculus Mouse MAALKAGRGANWSLRAWRALGGIFWRKPPLLAPDLRALLTSGTPDSQIWMTYGTPSLPAQVPEGFLASRADLTSRTPDLWARLNVGTSGSSDQEARRSPGSRRREWLAVAVGAGGAVVLLLWGWGRGLSTVLAAVPAPPPTSPRSQYNFIADVVEKTAPAVVYIEILDRHPFSGREVPISNGSGFVVASDGLIVTNAHVVADRRRVRVRLPSGDTYEAMVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQNNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSWFGTSGSQRRYIGVMMLTLTPSILIELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEKLAQNAEDVYEAVRTQSQLAVRIRRGSETLTLYVTPEVTE q99ms3-1 Mpv17-like protein Mpv17l M-LP long protein protein mouse Mus musculus Mouse MASWWRAFPQAARRYPWPTNVLLYAGLFSAGDALQQRLRGGPADWRQTRRVATLAVTFHGNFNYVWLRLLERALPGRAPRTVLAKVLCDQTVGGPIALSAFYVGMSVLQGKDDIFLDLKQKFWNTYKSGLMYWPFVQLTNFSLVPVHWRTAYTGLCAFLWATFLCFSQQSGDGTLQSIFIFLRRKEASDKSPEK q99ms3-3 Mpv17-like protein Mpv17l M-LP short protein protein mouse Mus musculus Mouse MSVLQGKDDIFLDLKQKFWNTYKSGLMYWPFVQLTNFSLVPVHWRTAYTGLCAFLWATFLCFSQQSGDGTLQSIFIFLRRKEASDKSPEK mp17l_mouse Mpv17-like protein Mpv17l protein protein mouse Mus musculus Mouse MASWWRAFPQAARRYPWPTNVLLYAGLFSAGDALQQRLRGGPADWRQTRRVATLAVTFHGNFNYVWLRLLERALPGRAPRTVLAKVLCDQTVGGPIALSAFYVGMSVLQGKDDIFLDLKQKFWNTYKSGLMYWPFVQLTNFSLVPVHWRTAYTGLCAFLWATFLCFSQQSGDGTLQSIFIFLRRKEASDKSPEK mpv17l-htra2-1 3177154 N/A 3177161 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3177162 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false htra2-mpv17l-1 3177155 N/A 3177163 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3177161 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false mpv17l-htra2-2 3177156 N/A 3177164 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3177161 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false mpv17l-htra2-3 3177157 N/A 3177161 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3177163 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false htra2-mpv17l-2 3177158 N/A 3177164 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3177161 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false mpv17l-htra2-4 3177159 N/A 3177161 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3177162 unspecified role unspecified role bait bait Q99MS3-1:p.[Asp112Ala;Ile114Ala] D112A/I114A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false htra2-mpv17l-3 3177160 N/A 3177162 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3177161 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false