DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ rose-2008-1 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. DIP original experiment: DIP-260434X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Unraveling the molecular basis of subunit specificity in P pilus assembly by mass spectrometry. Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. Only protein-protein interactions imex curation rose-2008-2 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. DIP original experiment: DIP-260439X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Unraveling the molecular basis of subunit specificity in P pilus assembly by mass spectrometry. Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. Only protein-protein interactions imex curation rose-2008-3 ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. DIP original experiment: DIP-260444X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Unraveling the molecular basis of subunit specificity in P pilus assembly by mass spectrometry. Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. Only protein-protein interactions imex curation rose-2008-4 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. DIP original experiment: DIP-260435X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Unraveling the molecular basis of subunit specificity in P pilus assembly by mass spectrometry. Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. Only protein-protein interactions imex curation rose-2008-5 ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. DIP original experiment: DIP-260440X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Unraveling the molecular basis of subunit specificity in P pilus assembly by mass spectrometry. Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. Only protein-protein interactions imex curation rose-2008-6 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. DIP original experiment: DIP-260446X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Unraveling the molecular basis of subunit specificity in P pilus assembly by mass spectrometry. Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. Only protein-protein interactions imex curation rose-2008-7 ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. DIP original experiment: DIP-260445X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Unraveling the molecular basis of subunit specificity in P pilus assembly by mass spectrometry. Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. Only protein-protein interactions imex curation rose-2008-8 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. DIP original experiment: DIP-260436X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Unraveling the molecular basis of subunit specificity in P pilus assembly by mass spectrometry. Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. Only protein-protein interactions imex curation rose-2008-9 ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. DIP original experiment: DIP-260441X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Unraveling the molecular basis of subunit specificity in P pilus assembly by mass spectrometry. Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. Only protein-protein interactions imex curation rose-2008-10 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. DIP original experiment: DIP-260447X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Unraveling the molecular basis of subunit specificity in P pilus assembly by mass spectrometry. Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. Only protein-protein interactions imex curation rose-2008-11 ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. DIP original experiment: DIP-260442X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Unraveling the molecular basis of subunit specificity in P pilus assembly by mass spectrometry. Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. Only protein-protein interactions imex curation rose-2008-12 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. DIP original experiment: DIP-260437X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Unraveling the molecular basis of subunit specificity in P pilus assembly by mass spectrometry. Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. Only protein-protein interactions imex curation rose-2008-13 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. DIP original experiment: DIP-260448X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Unraveling the molecular basis of subunit specificity in P pilus assembly by mass spectrometry. Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. Only protein-protein interactions imex curation rose-2008-14 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. DIP original experiment: DIP-260438X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Unraveling the molecular basis of subunit specificity in P pilus assembly by mass spectrometry. Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. Only protein-protein interactions imex curation rose-2008-15 ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. DIP original experiment: DIP-260443X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Unraveling the molecular basis of subunit specificity in P pilus assembly by mass spectrometry. Rose RJ., Verger D., Daviter T., Remaut H., Paci E., Waksman G., Ashcroft AE., Radford SE. Only protein-protein interactions imex curation papf_ecolx Fimbrial adapter PapF papF protein protein ecolx Escherichia coli MIRLSLFISLLLTSVAVLADVQINIRGNVYIPPCTINNGQNIVVDFGNINPEHVDNSRGEVTKTISISCPYKSGSLWIKVTGNTMGGGQNNVLATNITHFGIALYQGKGMSTPLILGNGSGNGYGVTAGLDTARSTFTFTSVPFRNGSGILNGGDFQTTASMSMIYN papg1_ecolx Fimbrial adhesin PapGI papGI protein protein ecolx Escherichia coli MKKWFPAFLFLSLSGGNDALAGWHNVMFYAFNDYLTTNAGNVKVIDQPQLYIPWNTGSATATYYSCSGPEFASGVYFQEYLAWMVVPKHVYTNEGFNIFLDVQSKYGWSMENENDKDFYFFVNGYEWDTWTNNGARICFYPGNMKQLNNKFNDLVFRVLLPVDLPKGHYNFPVRYIRGIQHHYYDLWQDHYKMPYDQIKQLPATNTLMLSFDNVGGCQPSTQVLNIDHGSIVIDRANGNIASQTLSIYCDVPVSVKISLLRNTPPIYNNNKFSVGLGNGWDSIISLDGVEQSEEILRWYTAGSKTVKIESRLYGEEGKRKPGELSGSMTMVLSFP papa_ecolx Pap fimbrial major pilin protein papA protein protein ecolx Escherichia coli MIKSVIAGAVAMAVVSFGVNNAAPTIPQGQGKVTFNGTVVDAPCSISQKSADQSIDFGQLSKSFLEAGGVSKPMDLDIELVNCDITAFKGGNGAKKGTVKLAFTGPIVNGHSDELDTNGGTGTAIVVQGAGKNVVFDGSEGDANTLKDGENVLHYTAVVKKSSAVGAAVTEGAFSAVANFNLTYQ mint Polymerizes to form the thick (6.8 nm in diameter) rod of the pilus (also called fimbria). The rod is a right-handed helical cylinder with 3.28 papA subunits per turn. Pili are polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, and enable bacteria to colonize the epithelium of specific host organs paph_ecolx PAP fimbrial minor pilin protein papH protein protein ecolx Escherichia coli MRLRFSVPLFFFGCVFVHGVFAGPFPPPGMSLPEYWGEEHVWWDGRAAFHGEVVRPACTLAMEDAWQIIDMGETPVRDLQNGFSGPERKFSLRLRNCEFNSQGGNLFSDSRIRVTFDGVRGETPDKFNLSGQAKGINLQIADVRGNIARAGKVMPAIPLTGNEEALDYTLRIVRNGKKLEAGNYFAVLGFRVDYE mint Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs PapH seems to anchor the pilus to the bacterial cell. In addition the stoichiometric relationship between papH and papA determines the pilus length papd_ecolx Chaperone protein PapD papD protein protein ecolx Escherichia coli MIRKKILMAAIPLFVISGADAAVSLDRTRAVFDGSEKSMTLDISNDNKQLPYLAQAWIENENQEKIITGPVIATPPVQRLEPGAKSMVRLSTTPDISKLPQDRESLFYFNLREIPPRSEKANVLQIALQTKIKLFYRPAAIKTRPNEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVKSANYNTPYLSYINDYGGRPVLSFICNGSRCSVKKEK pape_ecolx Fimbrial protein PapE papE protein protein ecolx Escherichia coli MKKIRGLCLPVMLGAVLMSQHVHAVDNLTFRGKLIIPACTVSNTTVDWQDVEIQTLSQNGNHEKEFTVNMRCPYNLGTMKVTITATNTYNNAILVQNTSNTSSDGLLVYLYNSNAGNIGTAITLGTPFTPGKITGNNADKTISLHAKLGYKGNMQNLIAGPFSATATLVASYS papk_ecolx Fimbrial adapter PapK papK protein protein ecolx Escherichia coli MIKSTGALLLFAALSAGQAIASDVAFRGNLLDRPCHVSGDSLNKHVVFKTRASRDFWYPPGRSPTESFVIRLENCHATAVGKIVTLTFKGTEEAALPGHLKVTGVNAGRLGIALLDTDGSSLLKPGTSHNKGQGEKVTGNSLELPFGAYVVATPEALRTKSVVPGDYEATATFELTYR papf-papg-1 3176825 N/A 3176840 unspecified role unspecified role unspecified role unspecified role Region 20-31 Region 20-31 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3176841 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false papa-papa-1 3176826 N/A 3176842 unspecified role unspecified role unspecified role unspecified role Region 23-41 Region 23-41 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3176842 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false papd-paph-1 3176827 N/A 3176843 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3176844 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false pape-papf-1 3176828 N/A 3176845 unspecified role unspecified role unspecified role unspecified role Region 25-36 Region 25-36 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3176840 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false papa-papd-1 3176829 N/A 3176842 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3176844 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false pape-pape-1 3176830 N/A 3176845 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3176845 unspecified role unspecified role unspecified role unspecified role Region 25-36 Region 25-36 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false papd-papk-2 3176831 N/A 3176846 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3176844 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false pape-papk-1 3176832 N/A 3176846 unspecified role unspecified role unspecified role unspecified role Region 22-32 Region 22-32 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3176845 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false papd-pape-2 3176833 N/A 3176845 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3176844 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false papd-papf-1 3176834 N/A 3176840 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3176844 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false papd-papf-2 3176835 N/A 3176840 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3176844 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false papa-papk-1 3176836 N/A 3176842 unspecified role unspecified role unspecified role unspecified role Region 23-41 Region 23-41 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3176846 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false papd-papg-1 3176837 N/A 3176841 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3176844 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false papa-paph-1 3176838 N/A 3176842 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3176843 unspecified role unspecified role unspecified role unspecified role Region 45-55 Region 45-55 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false papd-papg-2 3176839 N/A 3176841 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3176844 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false