DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ silva-2008-1 in vitro In vitro crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Silva RA., Huang R., Morris J., Fang J., Gracheva EO., Ren G., Kontush A., Jerome WG., Rye KA., Davidson WS. DIP original experiment: DIP-113342X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Structure of apolipoprotein A-I in spherical high density lipoproteins of different sizes. Silva RA., Huang R., Morris J., Fang J., Gracheva EO., Ren G., Kontush A., Jerome WG., Rye KA., Davidson WS. Only protein-protein interactions imex curation apoa1_human Apolipoprotein A-I APOA1 Apolipoprotein A1 protein protein human Homo sapiens Human MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ apoa1-2 3176573 N/A 3176574 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false