DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ vlach-2008-1 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Vlach J., Lipov J., Rumlová M., Veverka V., Lang J., Srb P., Knejzlík Z., Pichová I., Hunter E., Hrabal R., Ruml T. DIP original experiment: DIP-111247X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx f.2 Vlach J., Lipov J., Rumlová M., Veverka V., Lang J., Srb P., Knejzlík Z., Pichová I., Hunter E., Hrabal R., Ruml T. Only protein-protein interactions imex curation vlach-2008-2 chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Vlach J., Lipov J., Rumlová M., Veverka V., Lang J., Srb P., Knejzlík Z., Pichová I., Hunter E., Hrabal R., Ruml T. DIP original experiment: DIP-111248X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx f.3 Vlach J., Lipov J., Rumlová M., Veverka V., Lang J., Srb P., Knejzlík Z., Pichová I., Hunter E., Hrabal R., Ruml T. Only protein-protein interactions imex curation dylt1_human Dynein light chain Tctex-type 1 T-complex testis-specific protein 1 homolog Protein CW-1 DYNLT1 TCTEL1 TCTEX1 TCTEX-1 protein protein human Homo sapiens Human MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI gag_mpmv Gag polyprotein Pr78 gag Core polyprotein protein protein mpmv Mason-Pfizer monkey virus (MPMV) Simian Mason-Pfizer virus MPMV MGQELSQHERYVEQLKQALKTRGVKVKYADLLKFFDFVKDTCPWFPQEGTIDIKRWRRVGDCFQDYYNTFGPEKVPVTAFSYWNLIKELIDKKEVNPQVMAAVAQTEEILKSNSQTDLTKTSQNPDLDLISLDSDDEGAKSSSLQDKGLSSTKKPKRFPVLLTAQTSKDPEDPNPSEVDWDGLEDEAAKYHNPDWPPFLTRPPPYNKATPSAPTVMAVVNPKEELKEKIAQLEEQIKLEELHQALISKLQKLKTGNETVTHPDTAGGLSRTPHWPGQHIPKGKCCASREKEEQIPKDIFPVTETVDGQGQAWRHHNGFDFAVIKELKTAASQYGATAPYTLAIVESVADNWLTPTDWNTLVRAVLSGGDHLLWKSEFFENCRDTAKRNQQAGNGWDFDMLTGSGNYSSTDAQMQYDPGLFAQIQAAATKAWRKLPVKGDPGASLTGVKQGPDEPFADFVHRLITTAGRIFGSAEAGVDYVKQLAYENANPACQAAIRPYRKKTDLTGYIRLCSDIGPSYQQGLAMAAAFSGQTVKDFLNNKNKEKGGCCFKCGKKGHFAKNCHEHAHNNAEPKVPGLCPRCKRGKHWANECKSKTDNQGNPIPPHQGNGWRGQPQAPKQAYGAVSFVPANKNNPFQSLPEPPQEVQDWTSVPPPTQY gag-dynlt1-1 3174905 N/A 3174907 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3174908 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false dynlt1-gag-1 3174906 N/A 3174908 unspecified role unspecified role prey prey chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey N/A 3174907 unspecified role unspecified role bait bait myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association false false false