DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ contento-2008-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Contento RL., Molon B., Boularan C., Pozzan T., Manes S., Marullo S., Viola A. DIP original experiment: DIP-132926X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx CXCR4-CCR5: a couple modulating T cell functions. Contento RL., Molon B., Boularan C., Pozzan T., Manes S., Marullo S., Viola A. Only protein-protein interactions imex curation contento-2008-2 human Homo sapiens Human bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret predetermined predetermined participant predetermined Contento RL., Molon B., Boularan C., Pozzan T., Manes S., Marullo S., Viola A. DIP original experiment: DIP-132928X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx CXCR4-CCR5: a couple modulating T cell functions. Contento RL., Molon B., Boularan C., Pozzan T., Manes S., Marullo S., Viola A. Only protein-protein interactions imex curation contento-2008-3 human Homo sapiens Human bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret predetermined predetermined participant predetermined Contento RL., Molon B., Boularan C., Pozzan T., Manes S., Marullo S., Viola A. DIP original experiment: DIP-132927X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx CXCR4-CCR5: a couple modulating T cell functions. Contento RL., Molon B., Boularan C., Pozzan T., Manes S., Marullo S., Viola A. Only protein-protein interactions imex curation ccr5_human C-C chemokine receptor type 5 HIV-1 fusion coreceptor CHEMR13 CCR5 CMKBR5 protein protein human Homo sapiens Human MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL cxcr4_human C-X-C chemokine receptor type 4 Stromal cell-derived factor 1 receptor Fusin Leukocyte-derived seven transmembrane domain receptor LCR1 FB22 NPYRL HM89 CXCR4 Lipopolysaccharide-associated protein 3 protein protein human Homo sapiens Human MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS ccr5-cxcr4-3 3174816 N/A 3174819 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3174820 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false ccr5-1 3174817 N/A 3174819 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3174819 unspecified role unspecified role fluorescence donor fluorescence donor RLuc-tag RLuc-tag renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human direct interaction direct interaction false false false ccr5-cxcr4-4 3174818 N/A 3174819 unspecified role unspecified role fluorescence donor fluorescence donor RLuc-tag RLuc-tag renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3174820 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human direct interaction direct interaction false false false