DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ jansson-2008-1 in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Jansson D., Ng AC., Fu A., Depatie C., Al Azzabi M., Screaton RA. DIP original experiment: DIP-111233X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Glucose controls CREB activity in islet cells via regulated phosphorylation of TORC2. Jansson D., Ng AC., Fu A., Depatie C., Al Azzabi M., Screaton RA. Only protein-protein interactions imex curation jansson-2008-2 in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Jansson D., Ng AC., Fu A., Depatie C., Al Azzabi M., Screaton RA. DIP original experiment: DIP-111235X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Glucose controls CREB activity in islet cells via regulated phosphorylation of TORC2. Jansson D., Ng AC., Fu A., Depatie C., Al Azzabi M., Screaton RA. Only protein-protein interactions imex curation jansson-2008-3 in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Jansson D., Ng AC., Fu A., Depatie C., Al Azzabi M., Screaton RA. DIP original experiment: DIP-111234X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Glucose controls CREB activity in islet cells via regulated phosphorylation of TORC2. Jansson D., Ng AC., Fu A., Depatie C., Al Azzabi M., Screaton RA. Only protein-protein interactions imex curation jansson-2008-4 in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Jansson D., Ng AC., Fu A., Depatie C., Al Azzabi M., Screaton RA. DIP original experiment: DIP-111236X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Glucose controls CREB activity in islet cells via regulated phosphorylation of TORC2. Jansson D., Ng AC., Fu A., Depatie C., Al Azzabi M., Screaton RA. Only protein-protein interactions imex curation crtc2_mouse CREB-regulated transcription coactivator 2 Torc2 Crtc2 Transducer of regulated cAMP response element-binding protein 2 protein protein mouse Mus musculus Mouse MATSGANGPGSATASASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAYTRSSHYGGSLPNVNQIGCGLAEFQSPLHSPLDSSRSTRHHGLVERVQRDARRMVSPLRRYPRHIDSSPYSPAYLSPPPESGWRRMMPWGNLPAEKGQLFRLPSALNRTSSDSALHTSVMNPNPQDTYPGPTPPSVLPSRRGGGFLDGEMDAKVPAIEENVVDDKHLLKPWDAKKLSSSSSRPRSCEVPGINIFPSPDQPANVPVLPPAMNTGGSLPDLTNLHFPPPLPTPLDPEETVYPSLSGGNSTTNLTHTMTHLGISGGLGLGPSYDVPGLHSPLSHPSLQSSLSNPNLQASLSSPQPQLQGSHSHPSLPASSLAHHALPTTSLGHPSLSAPALSSSSSSSSTSSPVLSAPPYPASTPGASPRHRRVPLSPLSLPAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLPTDQRLPPYPYSPPSLVIPTHPPTPKSLQQLPSQACLVQPSGGQPPGRQPHYGALYPPGSSGHGQQPYHRPINDFSLGNLEQFNMESPSTSLVLDPPAFSEGPGFLGSEGSMSGPQDPHVLNHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSASGLELGLGLEDELRMEPLGLEGLTMLSDPCALLPDPAVEDSFRSDRLQ Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 with TAF4. Regulates gluconeogenesis as a component of the LKB1/AMPK/TORC2 signaling pathway. Regulates the expression of specific genes such as the steroidogenic gene, StAR. Potent coactivator of PPARGC1A and inducer of mitochondrial biogenesis in muscle cells mint 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN mark2_human Serine/threonine-protein kinase MARK2 MAP/microtubule affinity-regulating kinase 2 ELKL motif kinase 1 PAR1 homolog MARK2 EMK1 PAR1 homolog b protein protein human Homo sapiens Human MSSARTPLPTLNERDTEQPTLGHLDSKPSSKSNMIRGRNSATSADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGYKSSELEGDTITLKPRPSADLTNSSAPSPSHKVQRSVSANPKQRRFSDQAAGPAIPTSNSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTNRSRNSPLLERASLGQASIQNGKDSLTMPGSRASTASASAAVSAARPRQHQKSMSASVHPNKASGLPPTESNCEVPRPSTAPQRVPVASPSAHNISSSGGAPDRTNFPRGVSSRSTFHAGQLRQVRDQQNLPYGVTPASPSGHSQGRRGASGSIFSKFTSKFVRRNLSFRFARRNLNEPESKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNEMMREIRKVLDANSCQSELHEKYMLLCMHGTPGHEDFVQWEMEVCKLPRLSLNGVRFKRISGTSMAFKNIASKIANELKL aapk1_human 5'-AMP-activated protein kinase catalytic subunit alpha-1 PRKAA1 AMPK1 Tau-protein kinase PRKAA1 Acetyl-CoA carboxylase kinase Hydroxymethylglutaryl-CoA reductase kinase protein protein human Homo sapiens Human MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ mark3_human MAP/microtubule affinity-regulating kinase 3 Cdc25C-associated protein kinase 1 C-TAK1 Serine/threonine-protein kinase p78 Ser/Thr protein kinase PAR-1 Protein kinase STK10 MARK3 CTAK1 EMK2 ELKL motif kinase 2 protein protein human Homo sapiens Human MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTVGGKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITATYLLLGRKSSELDASDSSSSSNLSLAKVRPSSDLNNSTGQSPHHKVQRSVSSSQKQRRYSDHAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSSTVPSSNTASGGMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVASTHSISSAATPDRIRFPRGTASRSTFHGQPRERRTATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRRNMSFRFIKRLPTEYERNGRYEGSSRNVSAEQKDENKEAKPRSLRFTWSMKTTSSMDPGDMMREIRKVLDANNCDYEQRERFLLFCVHGDGHAENLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL crtc2-ywhab-1 3174720 N/A 3174724 unspecified role unspecified role bait bait Region 1-321 Region 1-321 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q3U182:p.Ser171Ala S171A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q3U182:p.[Ser171Ala;Ser275Ala] S171A/S275A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3174725 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false crtc2-mark2-1 3174721 N/A 3174724 enzyme target enzyme target substrate substrate unspecified role unspecified role Q3U182:p.Ser171Ala S171A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q3U182:p.Ser275Ala S275A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Region 161-179 Region 161-179 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Region 267-283 Region 267-283 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3174726 enzyme enzyme unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false crtc2-prkaa1-1 3174722 N/A 3174724 enzyme target enzyme target substrate substrate unspecified role unspecified role Q3U182:p.Ser171Ala S171A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q3U182:p.Ser275Ala S275A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Region 161-179 Region 161-179 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Region 267-283 Region 267-283 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3174727 enzyme enzyme unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false crtc2-mark3-1 3174723 N/A 3174724 enzyme target enzyme target substrate substrate unspecified role unspecified role Q3U182:p.Ser171Ala S171A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q3U182:p.Ser275Ala S275A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Region 161-179 Region 161-179 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Region 267-283 Region 267-283 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3174728 enzyme enzyme unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false