DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ monahan-2008-1 schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. DIP original experiment: DIP-132492X Nature structural & molecular biology 2008 IMEx Fission yeast SWI/SNF and RSC complexes show compositional and functional differences from budding yeast. Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. Only protein-protein interactions imex curation imex curation monahan-2008-2 schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. DIP original experiment: DIP-132497X Nature structural & molecular biology 2008 IMEx Fission yeast SWI/SNF and RSC complexes show compositional and functional differences from budding yeast. Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. Only protein-protein interactions imex curation imex curation monahan-2008-3 schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. DIP original experiment: DIP-132502X Nature structural & molecular biology 2008 IMEx Fission yeast SWI/SNF and RSC complexes show compositional and functional differences from budding yeast. Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. Only protein-protein interactions imex curation imex curation monahan-2008-4 schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. DIP original experiment: DIP-132494X Nature structural & molecular biology 2008 IMEx Fission yeast SWI/SNF and RSC complexes show compositional and functional differences from budding yeast. Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. Only protein-protein interactions imex curation imex curation monahan-2008-5 schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. DIP original experiment: DIP-132501X Nature structural & molecular biology 2008 IMEx Fission yeast SWI/SNF and RSC complexes show compositional and functional differences from budding yeast. Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. Only protein-protein interactions imex curation imex curation monahan-2008-6 schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. DIP original experiment: DIP-132495X Nature structural & molecular biology 2008 IMEx Fission yeast SWI/SNF and RSC complexes show compositional and functional differences from budding yeast. Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. Only protein-protein interactions imex curation imex curation monahan-2008-7 schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. DIP original experiment: DIP-132499X Nature structural & molecular biology 2008 IMEx Fission yeast SWI/SNF and RSC complexes show compositional and functional differences from budding yeast. Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. Only protein-protein interactions imex curation imex curation monahan-2008-8 schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. DIP original experiment: DIP-132503X Nature structural & molecular biology 2008 IMEx Fission yeast SWI/SNF and RSC complexes show compositional and functional differences from budding yeast. Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. Only protein-protein interactions imex curation imex curation monahan-2008-9 schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. DIP original experiment: DIP-132496X Nature structural & molecular biology 2008 IMEx Fission yeast SWI/SNF and RSC complexes show compositional and functional differences from budding yeast. Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. Only protein-protein interactions imex curation imex curation monahan-2008-10 schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. DIP original experiment: DIP-132498X Nature structural & molecular biology 2008 IMEx Fission yeast SWI/SNF and RSC complexes show compositional and functional differences from budding yeast. Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. Only protein-protein interactions imex curation imex curation monahan-2008-11 schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. DIP original experiment: DIP-132493X Nature structural & molecular biology 2008 IMEx Fission yeast SWI/SNF and RSC complexes show compositional and functional differences from budding yeast. Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. Only protein-protein interactions imex curation imex curation monahan-2008-12 schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. DIP original experiment: DIP-132500X Nature structural & molecular biology 2008 IMEx Fission yeast SWI/SNF and RSC complexes show compositional and functional differences from budding yeast. Monahan BJ., Villén J., Marguerat S., Bähler J., Gygi SP., Winston F. Only protein-protein interactions imex curation imex curation taf14_schpo Transcription initiation factor TFIID subunit 14 tfg3 taf14 SPAC22H12.02 TBP-associated factor 14 TBP-associated factor 30 kDa Transcription initiation factor TFIIF 30 kDa subunit Transcription factor G 30 kDa subunit SWI/SNF chromatin-remodeling complex subunit tfg3 SWI/SNF complex subunit tfg3 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MTTVKRTVRLITDQNVLPGGEAAVLNDQSFPVREWSIKLVCLNPQGEETDASFVDRVTYKLHPTFQNPTRTIRKPPFQIKEQGWGEFEMEIIIYYADKGGEHRFLHYLHFQQEHYHEDIELNINATRPGLLKALTATGEVPGYSDEGEEARKDKRKNESEVGAGKKKAKAKPVDMDKLAEGLQKLQEDDLLQVVQMVNENKTPDMYVRNDIEGGEFHIDLYTLPDNLLLLLYSFCAKRVTM 278FAF8B67883D46 snf30_schpo SWI/SNF chromatin-remodeling complex subunit snf30 snf30 SWI/SNF complex subunit snf30 SPAC23G3.07c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSFVSKSPPIVNSASPTGQVNPMEVEKANKLLEINRLILWKCLELQHIKTAQNSTLEQRALSTELFNSYIQRLKANLAFVVSIASPRQMQVLTPPLSCPESLPQLEPLYKELRQYFQIAQTSTLSYPPSNGDSSSYANGTDLHGNTGTMQQEEKANPSLTRSDSVSSGSYITMQGANSLKAQQDLLNSFTGAPSNNSHNIPDPNLSQTFSATSMGPPNNNYSKFRTDNYLARSSNRSGTPNIQNEQSRFFDSQQAQVQARALMQRYQQGMEFNK 6C746130FDBE3524 ssr4_schpo SWI/SNF and RSC complexes subunit ssr4 ssr4 SPBP23A10.05 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAATMAAQSLLSIPVEYRSQVWCRANLPYPPAPQLPIPAVVDILTKASQALPQISFSWTLIDQPPDGSLFLVWQAPTLPSPPDGMHFMSNERFFNMDVAGKVLEIHEAKHGFYPLSETRTMHVRCRYRLLGVGFDNFWLVHYFQGSETDSIPANISVAKPPHLRRYPLPDVKTSPFLLQEPKKHIPEGTALSQRETLPNMGSAQMKSQSRTPSFSNVTTSPVPPINSNATAQTAEGHMGATNMTVDNMNKPSIPPNGNTSILMQEDLEIEKGDVMDKLSPQQICTARFIKHAEWMSQVLLTLQSVKDIEPPALWQEPNSMEELGKELKDNKEQLVKQDQKYQSLQGDLSYTDSMSNLLKEFSNIKSAEECDVLQKKIEEFAEAKIVPLSHVTERS 4A2586D0D72A55CE ssr3_schpo SWI/SNF and RSC complexes subunit ssr3 ssr3 SPAC23G3.10c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSNNSRLPENGVQSGNGEDAELKKSMRIIEREIPDSLLEKIPEAEDYIALQDLERKLDSLIVRKRFDLQDSLSRNSHKTRILRMYIHSTVANQSWQQKGENQENNSGDINSLPIPEWTLHIEGRLLVNPDDEDDKAFELAPFTNFFRKIAIQILRSDDLYPSGNYVEWNKLPDNSNTSNGITVTRKGDQSVDVKIMLYPEEHPERYKLSKAFANILGIREGTRPDIVSYLWQYIKFHRLQDMEEKRLINCDKALRDLFEADRLYFPRIPELMNRFLEPIDPIVIPYTINVSEHTVEKVTIFDIRINTEDPRHSQIRSFLATMMSQDKIRSIDDKLTELIQAITYSQSKYDFMKKFSESPIEFINEWIESQSRDLEIVLDGTNMNYAEKRSADYYQQPWVHESAFHYLNLLNSKKQQSVLNASAKK 26D420E6CEF71058 arp42_schpo SWI/SNF and RSC complexes subunit arp42 arp42 Actin-related protein 42 Chromatin structure-remodeling complex subunit arp42 arp4 SPAC23D3.09 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEEIPSLVIDPGSCWTRFGYAGEESPMTILPSYYGVRSDVTGRNKYVVDELQIHAPIPGMEVKNGKSNGIIQDWESTLYTWERGLKEKLQVNPTEYAMMITEPSWNPQSVRQQIMEAAFEQLHVPAFYLTKQAVCVAFANSKSTALIVDIGSDNASVTPVVDGLIIRKGIFKQSLAGDFLNANIEQLFNTMNIEFPPHYRIARKSVAIQQSGNMANGSADAVKPAVLYPPIQDLTSSYEIFQKRRVIEEWKESVLDVLDTPFDEAKASSRNPKPFEFPDGVTHKFGQERFRISEILFNPSFSASRSAETTPPQGSVGLHELVYQSILACDSELRSPLLNNIVVTGGTSLIPGLSERLQAEVQRLATGSRINVHTAETASATSNAVWFGGSILASLDNFQHLWVSKQEYDEVGVDRALFVEKRCK 97F0C4B746A10748 ssr2_schpo SWI/SNF and RSC complexes subunit ssr2 ssr2 SPAC23H3.10 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MTLDQVRIPFLVEQTYPIIVPSYAGWFDMSKIHDIERRSNPEFFNGKSPLKTPSIYKDYRDFMINSYRLEPNEYLTVTACRRNLVGDVCAIIRVHAFLEQWGLINYQIDPETRPAFRLPPISGHVQAISNTPIVTQEMLAQHPPPSTVGGSSSQEFVKLEEKHYSPSLNAMEQTSPKEEDEKSDKVPRVDKVCFTCGVNCSQTWYHNLKNKKYDICPNCYKQGRFSSSFNSSDFLCMDAIDFNHDEEKPWSNQETLLLLEAIETYGDDWNQIALHVGSRTKEQCLIHFLQIPIEDPYRQKLQGDFSPFKKGFLPFDENENPVLSTLTYLASIVQQGMKERKQNESVKQGETSFGNSEFKNPLERVAYYALKSAAQKAKLIAAFENRQLRRLVFSLIQAQLEKLQLKMKVLEQLEKMCSLELSELDLRGKNLLLSRLSTKKMLLAFNKKLEEAVNLGGEDGLKIIDDLMSTEHAEALLTFEMPTATTVSPLSKQYPDKFRTIAL 41FA0BEE2E372114 snf59_schpo SWI/SNF global transcription activator complex subunit snf59 snf59 SPBC26H8.09c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEEEDITLEHSDDLNKEESGESNRVNIEEPEHHDNSNKESTNLDDLNMLEEPKYHDNSNKESTNLDDLNMLEEPEHHDNSKKESTNLDDSNMLEEPKHHDNSNKESTNLDDLNMSEEPKHHDSSNKESTNLDNSNMDESENQKNFKIEEPKPSGDFRNEGPKQCDDSKIEKPELHVNSKIEEPIHRIDSEHNEPEYHTESKNEESEHNTKSIREEPIHHVDSKNEEPVYSKIPEKMGDEFSENSLSKSDSAVKQEGNLLIHPNNSLKDTAPSKCKEPPVDEALSKKEISDDIAQITSVTPITEKIEDKDKYISEVIDTYGKLADGFEYRAKTFCLEGRGKVLYMLGTECSRLLGFKDSYFMFHKTPSLRKVLTTQSERDQMVEMGLLASNFRFRQLSIVPARQMFLAFGARILMKGTIDPESHKALIEKNISWADDEYYHMDVMANGSTRSSSVKLELKSMDNQNSPSPFQGKDILTLAQGASFYNSKVMRTRNLRKEARLSYYTKLRGVNRSVS 41F6F294909739B6 arp9_schpo SWI/SNF and RSC complexes subunit arp9 arp9 Actin-like protein arp9 Actin-related protein 9 Chromatin structure-remodeling complex subunit arp9 SPAC1071.06 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MPSFRDDHIIVIQTGSLYHRATFGLAESLEPPTIRVRTRVGKNDNGEYVFTNKEDINMEDPNVKTDETKVETSESTSEQPSNSNVTEEKNMGSSFHSECKVDDFTPLPNEIQPIQRGRVVDWEALKAFWKHLYSLLLKDPNDTTFRYPVCLVIPTYWSLYDRELATQFFFEECQVPGFTIAYEPLMGLYAIGILHGLVIDIGYEKTDITPILDGQIIFTATQQLPLGGRYMTQHLQNLLRESLPTLKSSGQYVSKEDITELFAEQVKCSEIAQVVRDEQDTAKDPVKALTSTNNVEEEDPAEDIGKIIASGQTRAYLAQKEREKNGESEKDEKPDNTDVEFQTIAIEPLGDCIVGRERFKICEPIFHRPSNETVSLPEAIYITIKNYAANYKRRNDLWENIIVLGCGSRIRGFRECLIQQLQFKYQLSGSLEPYYAAQGTDSILGMTTMPPTPYPALINPCKILPDYFPSWKPDAGTNAMFEELAFLGGSIVAKTSFNESVSSHYVTLEEYAQHGPTAIHTKQ D51F4D57B4228FF7 ssr1_schpo SWI/SNF and RSC complexes subunit ssr1 ssr1 SPAC17G6.10 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSNVTENKHDLHENGVPDSAQPMELDVSKKEDTEPEVRDEAKEFLLSQLPQVEVPEWAQWFDFSKVHEIEKKQNPEFFDGKNTSKTPEVYKEYRDFMISTFRLNSKVYLTFTACRRNLAGDVCAVLRVHRFLEQWGLINYNVNPDTRPSKIGPPSTSHFQILADTPRGLVPLLPPPSSSIPRSKAVTIEDPSIVRTNIYDPSLDDVLKGKGSTPNQKPSLSNLHENNIDQSDSPQHCYCCGNKFNESYYQSQTAQKYNVCISCYQQNRFPSPTTIADYKEVAIQNKIEDDDTWTAQELVLLSEGVEMYSDDWAKVASHVNTKSVEECILKFLNLPSSDKALFKMDKVHTNPVVDSLQGKNPILSVVSFLAKMVPPSSFTQKSSAKEEESDKVKGESVYPKPESESYDVEMNGKSLEDSDSLSELYLTNEEKKMASIIKDSVNVQIKLIESKLSHFDYLDQHIRLKSQELDAFAQATYREKLYMKRECQNARKKIEQQLQSKDTAANGLPVQSSAETSVIPASSMSPS F868122EE93E75DF snf5_schpo SWI/SNF chromatin-remodeling complex subunit snf5 snf5 SWI/SNF complex subunit snf5 SPAC2F7.08c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MDKDIGSAVAELQVCSTHYAMTIVSCGFHSPQSLMNADLQHCLLADQNYLLNNSNKNKGSIIEENTRKPFQSARNLQTSLKTHPESAITRYGLGYAGFGNGWTALKPKILFPSQKRRVKGRFTFPFSRRSNLAQSKLPVDLVPIRLEIDADRYKLRDSFTWNLYDKCISLDQFAEQICIDYDIPLHNVHIVQNISKSIQAQINDYEPRKAQSNLSFVSDVSSSTSETVYAHEPSDSLAKASKQQIPTVQNDLRILIKLDITIGRLNLIDQFEWNLFAPESSAEEFATVMCLDLGLSGEFCTAVAHSIREQCQMYIKYLSLIGYLFDGSEIEDEEVRSYILPPLKNTLRFSDMESSSFAPMIYELNDAEMERQDRGYDREARRMRRRQGRAKHGIMLPDLRDIPKIHRSLFPSSSVPSDDDFMHALSLSTNSDGETLNEINTNNPEREHLIVRLKVDSQKLKIIVEQSQTLTLNNFQQRKLTPLPNSMSFDSLNEFESERNTPSTYGQNISPLPQFSSPSLSSDAFLTNSNSSESALVHMQKLNLPDFTPSWVKRCVIETFAKFPNDRFNVIVKPALNPAERMTVRICCHDCINEYFTAGPGFTFGNFHIHLLSSSHQQKKEVRMNTVLDRNT 7153CFA105690953 sol1_schpo SWI/SNF chromatin-remodeling complex subunit sol1 sol1 SWI/SNF complex subunit sol1 Switch one-like protein Transcription regulatory protein sol1 SPBC30B4.04c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MNNQGFVPASDYPTAVSYPTQGQSYNTQEEQPAYPQRFSTSQGMYAAEYGNANMMNTSENEPNNLAHSQPFRQSPSTQRNLPNQSFDFASNGAWNGSGSVKYSSPMMPSSRIPFQQEKEAAMQQQQQQQQQQQLYQRQMQSREALLSQQIPPNQIGINAHPAVRQTPQPAPSPNTPSGNANQLTPAYAASFDKFMVSLISFMEKRGTPIKSYPQINNTPINLMMLYALVMRAGGSRQVSAHNFWPKISASLGFPSPDAISLLIQYYNSYLLPYEEAWLAAQQQQKSLQQAKANHSANVQSRPKNYPQKPVQTTPEAVHANGSMHGSLHSKSPSPAFTANRFSPAAPTTVSSERNAPPYPSAPTRPTPPTVQTSSSAAPVDSAEPVAYQPIKKPIDPMLGYPLNVAATYRLDESLLRLQMPSIVDLGTVNIQALCMSLQSTLEKEITYAMNVLLILTNDQKWMFPLSECQDVVDALIDVATQCLDNLLSVLPNEDLMEIADKRPSYRQLLYNCCVEISQFSREDFSNSLSENKTKDSINAIDVHNSEQNLLAVFVIFRNLSHFEANQNVLVQNPDFFPLLIRVVKSLNFHATSLLRSSRNTLDLHKDVLIVLCQLSQNFILPNVDVARHVLLFILSFSPFNRKKSKTILNDTLPTSIPSYTPATHPYAGPAINAYAKLLAKDANNKTNFQAIFDNNPKFLDSLFLLLASVVPKFNRHCLKICERRLPLLQQSFFCLAATVSYVKQSEQAANWCNIGEGFFVSMLRLLILLSGHPSLNPPSRVASQYPTTNPFRYVIQSGISTVRRLLSLVEAGNISLSSFPKSETLLAVLLAPTTETSFLKEISNLLDRTGDSDASLENTDDKSGI 0DEF2AEC233425A8 snf22_schpo SWI/SNF chromatin-remodeling complex subunit snf22 snf22 ATP-dependent helicase snf22 SWI/SNF complex subunit snf22 SPCC1620.14c SPCC830.01c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MFAVQGNQKFPKGLTKDNIQSLYQQWQVMRNQGATEENNPEFAQISSILRMVQRAHYARMQQMRNQSSEFPDAENTNLRKQQDTLPTTGFNNLPEGKAGMQTLPGRPASNGPTPPNPGNGNVGLNNPSYMNSQASPNIMNAPLQRDTSVPPAPSMVHPHTNTNANSNNLKVYANQLSQQNTSNPTYHNAYDMASMMKNGSRMNNSFPPTTPYPPANDTTVNSSLPHSFASPSSTFEQPHTVQSRAPSVDTTSSSHSFSARNIPANVSMQQQMGRRGSIPVNPSTFSASSPPSGSMLASPYNGYQNDAASFAHSKLPSSANPNTPFNSTATVDVGAAGSHFPYPQPSNLDAINAKTYFQSSSNSPAPYVYRNNLPPSATSFQPSSSRSPSVDPNTVKSAQHIPRMSPSPSASALKTQSHVPSAKVPPTSKLNHAQLAMLKSQIVAYNCLNSPNGQVPPAVQQAIFGRVYGASNEVSPSMPFQQNVPQMSSVKKDTPTRDANMRTSKAPYIQNIPNQFQRRAYSATIPVKNESLAKPSVSPMPLQQSTGKTEVAKRAQFPTNVNYSSCVDPRTYVKTPIPFSKFSSSENLSLIPSLLPPSISWDDVFLSSEIAIACSIANRIDFLEKENRPKSVNKKILQQDKSKSMIELRCLRLLEKQRSLRETINSVIPHSDSLAAGNLRLMFRNVKRQTMQEANLVLALAEKQKTEHAMRQKEKLLTHLRSIMLHRKSIVTKVDKQNKAKTQRCKDIINFHAHLEKEEKKRIERSARQRLQALRADDEAAYLQLLDKAKDTRITHLLKQTDQYLENLTRAVRIQQSNIHSGNTSGKGSNSAELEAPISEEDKNLDYFKVAHRIHEEVEQPKIFVGGTLKDYQLKGLEWMLSLYNNNLNGILADEMGLGKTIQTIAFITYLIEKKNQQGPFLIIVPLSTLTNWIMEFEKWAPSVKKIAYKGPPQLRKTLQSQIRSSNFNVLLTTFEYIIKDRPLLSRIKWVHMIIDEGHRIKNTQSKLTSTLSTYYHSQYRLILTGTPLQNNLPELWALLNFVLPKIFNSIKSFDEWFNTPFANTGGQDKIGLNEEEALLIIKRLHKVLRPFLFRRLKKDVEKELPDKVEKVIKCPLSGLQLKLYQQMKKHGMLFVDGEKGKTGIKGLQNTVMQLKKICNHPFIFEDVERAIDPSGTNVDLLWRAAGKFELLDRILPKLFLTGHKTLMFFQMTQIMTIMEDYLRSKNWKYLRLDGSTKSDDRCSLLAQFNDPKSDVYIFMLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQTKEVRILRLITEKSIEENILSRAQYKLDLDGKVIQAGKFDNKSTPEEREAFLRSLLEHDGDDDHDLTYGELQDDELNELISRTDEELVLFKKLDKERAATDIYGKGKPLERLLTVNELPDFYKVEVDSFAVQSSSELEDQYLERKRRRRNSISYTELTLDELNTVDDPSSTLMPRKRGRPRKKTNSGSSLSTPLSQESSLARSGRKNTPSYKQKALRRYCMEIFERLYNLQSEDGRFVNGLFLYPPNRKLYPDYYIIIKRPIALGKIKRNIKNDRYGDVGELIADFMLMFNNAYTYNEEHSIVYEDAKLMEKTLKEVIEDLEKNNSLHAYEEEALNEEQASLVFLENSEAELPLDSGIVSAEDDKVITYEDSSSSYSE 8D0B978979768775 sfh1_schpo Chromatin structure-remodeling complex subunit sfh1 sfh1 SPCC16A11.14 RSC complex subunit sfh1 SNF5 homolog 1 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAQACKTTYSSRLKTGNTCLIQKNVAVSTRSHSSYTGRNSLRNVPAVNYAAFEQGEDFETPVETPEKEEEKFETDDRGLAVGRPTGNNIYPRFATKTRHIYVTDEQLKCAAEERDVYIPIRLDIELPNNYRLKDTFLWNMNEQVMTPDVFAQILCADLDLSTNVYGTQISSSIRAQIEEYAPVAEVPMPKGQEMLVVFNIQVQLAQLSYNDQVEWNLTSPLTPEEFSVLTCNDLGLSGESRPEIAYAIHECLLKLKKNACEGDLPDYDSDAVPGTKAGPRQDMDTLGALWQPVLETVSLEDAKKNENNRENLVKQWRREASKFGGFAADVSAERWRAAALGNLSQSETANLPSASVSDAQTLLEQERPRWRCRWCNVLGTGTFCVRRGPEGNKSLCNACGVAYAKTGQLPYWRKSLYT 00CBDC92BE975D26 rsc7_schpo Chromatin structure-remodeling complex subunit rsc7 rsc7 Remodel the structure of chromatin complex subunit 7 SPCC1281.05 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MDSTAGSDASTPTNHTVSSKKRRGRPPKGSYAAYGSSDDDDEEYSGRTRRRNRNTRPRVSAPSSSSTVVPKDLYSHRATLEDDELNFGVVDPEGEKKVNELGYLNGGREYRCRTFTCLGRGNRLYMLSTEPARAMGYRDSYLLFLKHRSLHKIIVDDSEKWDLIERNIIPHSYKGRAVGIVAARSIFREFGARIIVGGRRIVDDYWEGEFRARGFVEGELADPDDKLPPPGMPYNRNQYVAWHGASAVYHPQPSLEAQLPAAARKRKKEPPKDATWLFQHAKATAAYNNDITKYLVQKQDIGYFEPHTNLLHVPLNTQPTKTHWIQAKTGTECPAPKLDILVALNSDVAPQVSIANIPPSVYASCPLHVQEAIRKRQEQEIRSIRLNSMY 04123B06A14C7790 rsc58_schpo Chromatin structure-remodeling complex subunit rsc58 rsc58 RSC complex subunit rsc58 SPAC1F3.07c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MNAESCSLILSYISSAPAGNLVLNCTATTNKQTLEANLKSAVYQRYPEFLEDWTNVCVHIIHSYFPKDADYWNVDKLYTSVNRITTLEQSKVVGKEIKNGFTFDAENSTASLENDLQPQFRSHALFMVGSAGPLFSSTARTSRLDSRLPDGGIIAKPVALLPTPSVANSQEYTLDKLSPPSTAKPPASVIEFNPSLAKLPTVKYLQSGPFSSIAPYKNSSSSVIPDSSFHSVACYRASSHYKEAPVEKSIDIDIIQNNLSLLEEDSWTSVPIQGELVELNKLLQHLQLLQNQRITSHNVLSDEERQISVQVQNLILKLAKDYDMSPEDFLMDDFTLSLTQYGAFYRGTLPLSAQPLELPSQQLLRSQSNAALRSNSLSMNGSLSPSSTNVPLQSYRRTTKSRR 3882059A78880CDE rsc4_schpo Chromatin structure-remodeling complex subunit rsc4 rsc4 Bromodomain-containing protein brd1 RSC complex subunit rsc4 brd1 SPBC1734.15 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MVDDSHNAPFDKTKFDEVLEALVGLKDNEGNPFDDIFEELPSKRYFPDYYQIIQKPICYKMMRNKAKTGKYLSMGDFYDDIRLMVSNAQTYNMPGSLVYECSVLIANTANSLESKDGTLNEEENEEMESSINEEHKPGTNEIDVPKVIQNILDALHEEKDEQGRFLIDIFIDLPSKRLYPDYYEIIKSPMTIKMLEKRFKKGEYTTLESFVKDLNQMFINAKTYNAPGSFVYEDAEKLSQLSSSLISSFSEQPKEHSPATSKHEPEETPASPTPSVSASTSRERSTSVAPSFITSDQAATPDVLKSEEAHVESFSKESEKDQTPIPEDVPSPMDTLSQANYGAFALIKSFPSTPVPDFLNFSHKSVMGRSTFNMPNFPEPKFFEDIPNTERCILSAFICSPPQLPLPNPLRMYLPCPSLNSTEVSVITLAPQHSFLNIVINLNPALALKSYTIITLLNGKRLGAGVSTPPSTLYALEGIKHTEEPIRTVYEAKLSVGLNCLEFVLGSTEPVEPPSIEPGLPASAYSRTVERERFVLMAYVQP B900D1F77327C2A6 rsc9_schpo Chromatin structure-remodeling complex subunit rsc9 rsc9 RSC complex subunit rsc9 Remodel the structure of chromatin complex subunit 9 SPBC1703.02 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSQVIQGAVEEPVYSNKSLTNENDSFLSLIESFSQERGVPIDINPKIGRKPILLYELYKKVIKRGGYDAVSATEDGWTNIAEEFNQSDPARSAGILQNVYFKYLISWEIHDHWHLLLPPPSTLELSENRQNVLERVKVFNSCSPPKPTNPITIIDNDKTHSFKKFYKSLVKEDEENGIEKKINEAMNSSASQPLPNSTNFASTTFPSVPFHPLPVDSGLQKYIDRNSNLTPPALGAGVPGPPLLVRVALALKSQQDKEVDWAIGHLIKISFERHQEFKLERLPSLAECLVYSLGFQVTKAKQVSDLTDISLCMDRAIGIALVLRNSVLSVENAKHVAQTKLVISVLEASIRCAKTFNNLEFLHYCLDISEMISSYLHVEDEKNVFYLALCEFLNSSDYSILIATLRTLARLALNDRNNRLLQDLKSNVIANIIALVETDNEEIVAAALDFLYQYTTYRTNTSNLLASQEAWMLVDQLIRLMMYQAQERFMTVTIENSESNPAVKHEATSSISLPMEELQQLVAMREPERSVKWMRCCFEPSSDDYVLQTDIWQLYCSDMERAQGPNVMGISPADFIKVSSHAFYNARAMTVSTPQLPVEYVINGIKRRKFPTSVNGMRYQPCRWCLDSGKECGELLLGTPLLHSHLQEMHIFPQILETGKCRWSDCKYEIQRLTPASELSHYQLLSHIVTHLHDDSLETLVEGRKLSPSREFRIPLLLTAVDDQGDATGIALTATLVLRNLVRSKQGKMLFSAIESRVLEVSSLNPAVAPYVSEMLLGQI 76416645839716BC rsc1_schpo Chromatin structure-remodeling complex subunit rsc1 rsc1 RSC complex subunit rsc1 Remodel the structure of chromatin complex subunit 1 SPBC4B4.03 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSSKIRPSADDKKLQRVLYFFLERVRAAKDVSGQLLSPLIDNASVDTASVSPSSNGRPTTLKSIQSKIDEFQYHDFSEFVSDLAYLFINVKALYEGTQTYSFVQALEEFCIQQLRTFQQQGYIPVITWPNTDSPSATTSSPISRNPEYSVSPPNGSKFVKNEDEAYDSDLYVEEEDSDVKGRSMVGRDGRYKSEDLKRRKLQPSSKPLSSLEARAKVIMRQVRRYRDGSGRQLFAPFERLPDPRMFPEYYQAIEQPMALEVIQKKLSKHRYETIEQFVDDFNLMFDNAKSFNDPSSQVYRDADFLKNYLADVLRLEAGKLDSEFFNYETDSRASPQLPKNDIQPAVSIDGTLLNVGDWVLIRNPADSSKPIVSQIYRIWKSDDDINYVTVCWYLRPEQTVHRADAVFYENEVFKTSLYRDHPVSEIVGRCFVMYITRYIRGRPKGIRSTPVFVCESRYNDDTKQFSKIKSWKACMPQEVSGSEYEMILFDRPITLTKVASPLLHLLASKSQGLPSPATTDSNTHMLPSQGSLLPPSSISETKSFSTKASTPLSTDDIATPLSSAPNPPSVMPTYARKTSSHSERSSHSSYHNSSHVPTAAFNSPIMRTSTKSTSPIPARPFYAQSGSLQSLNTTQHSHQISGGHSGRMNVPYAKLSYTSHNGRHGGSNGNISGAKTPMTNYTINSMPSLPVFPPAFIVPGTHQKLDESSPVPGIDDVTVINTETAKMLDKDEHQNVLWYTVPPLDPIPLENRNGSLTHSVEYVLYKKSKGSQVITEKARSNELSREAKFENLVASLSDALIPP 2C2706CB022510F7 snf21_schpo Chromatin structure-remodeling complex subunit snf21 snf21 ATP-dependent helicase snf21 RSC complex subunit snf21 SPAC1250.01 SPAC29A4.21 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MRAEKQYTRNEVEETIVRWKKLKESGATEHDNTEYAQLCDVLRSAQSEIEARRDLKGHIKRCFSSVDKNTEKLILKQQVLAYKKLSQNLPAPDDCILSVLLRLSKDEQLLQSIVKQPLQNSKVDGKVRRDFGSCQITPSAKQQRKYLQYQISEDDAIKNRMFRRMSDLESYPAVMRDVAELKDDNERLNLDTIKRNALVELKKLRLIKQQESLRHQVMHCQPHLRTIVNAVERMSCRRPKLVPQATRLTEVLERQQRSDRERRLKQKQCDYLQTVCAHGREINVRTKNAQARAQKANRAVLAYHSHIEKEEQRRAERNAKQRLQALKENDEEAYLKLIDQAKDTRITHLLRQTDHYLDSLAAAVKVQQSQFGESAYDEDMDRRMNPEDDRKIDYYNVAHNIREVVTEQPSILVGGKLKEYQLRGLQWMISLYNNHLNGILADEMGLGKTIQTISLITHLIEKKRQNGPFLVIVPLSTLTNWTMEFERWAPSIVKIVYKGPPQVRKALHPQVRHSNFQVLLTTYEYIIKDRPLLSRIKWIYMIIDEGHRMKNTQSKLTNTLTTYYSSRYRLILTGTPLQNNLPELWALLNFVLPRIFNSIKSFDEWFNTPFANTGGQDKMELTEEESLLVIRRLHKVLRPFLLRRLKKDVEAELPDKVEKVIRCQMSGLQQKLYYQMKKHGMLYVEDAKRGKTGIKGLQNTVMQLKKICNHPFVFEDVERSIDPTGFNYDMLWRVSGKFELLDRILPKLFRSGHRILMFFQMTQIMNIMEDYLHYRQWRYLRLDGSTKADDRSKLLGVFNDPTAEVNLFLLSTRAGGLGLNLQTADTVIIFDSDWNPHQDLQAQDRAHRIGQTKEVRIYRLITEKSVEENILARAQYKLDIDGKVIQAGKFDNKSTPEEREAFLRSLLENENGEEENDEKGELDDDELNEILARGDDELRLFKQMTEDLERESPYGKNKEKERLIQVSELPEFYQREEPEKTTDLLQEEPLGRGARRRTPVVYDEAVRDAQWMAEMDMESEARPTRGRPKRNIASVDETPALTLNGKPKKKRGPAPDTLTSEHRSLLRRVCLEIYKAVNELEDDNGRPLNKLFLELPSKKLYPDYYMIIKSPIALDAIRKHINGTFYKTLEAMKSDLMTMFNNARTYNEEGSFVYEDANKMQTAMETKIEELEEDGTLATLRGMEAEATSQLEDRIENEA 1AD1C7299C4D0028 snf22-arp42-1 3174506 N/A 3174518 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174519 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174520 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174521 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174522 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174523 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174524 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174525 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174526 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174527 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174528 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174529 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false sfh1-arp42-1 3174507 N/A 3174530 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174531 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174532 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174533 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174534 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174535 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174536 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174520 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174521 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174522 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174523 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174525 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174526 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false arp9-arp42-1 3174508 N/A 3174530 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174518 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174531 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174532 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174533 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174534 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174535 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174536 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174519 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174520 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174521 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174522 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174523 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174524 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174525 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174526 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174527 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174528 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174529 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false snf59-arp42-1 3174509 N/A 3174518 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174519 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174520 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174521 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174522 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174523 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174524 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174525 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174526 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174527 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174528 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174529 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false arp42-arp9-1 3174510 N/A 3174530 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174518 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174531 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174532 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174533 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174534 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174535 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174536 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174519 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174520 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174521 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174522 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174523 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174524 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174525 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174526 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174527 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174528 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174529 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false snf30-arp42-1 3174511 N/A 3174518 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174519 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174520 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174521 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174522 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174523 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174524 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174525 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174526 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174527 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174528 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174529 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false rsc1-arp42-1 3174512 N/A 3174530 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174531 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174532 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174533 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174534 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174535 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174536 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174520 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174521 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174522 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174523 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174525 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174526 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false snf22-snf30-1 3174513 N/A 3174518 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174519 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174520 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174521 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174523 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174524 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174526 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174527 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174528 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174529 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false snf21-arp42-1 3174514 N/A 3174530 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174531 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174532 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174533 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174534 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174535 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174536 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174520 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174521 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174522 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174523 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174525 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174526 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false rsc7-arp42-1 3174515 N/A 3174530 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174531 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174532 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174533 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174534 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174535 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174536 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174520 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174521 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174522 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174523 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174525 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174526 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false snf5-arp42-1 3174516 N/A 3174518 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174519 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174520 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174521 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174522 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174523 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174524 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174525 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174526 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174527 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174528 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174529 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false snf21-rsc1-1 3174517 N/A 3174530 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174531 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174532 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174533 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174534 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174535 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174536 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174520 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174521 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174523 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3174526 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false