DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhou-2008-15 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113759X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-16 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113813X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-17 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113779X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-18 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113797X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-19 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113796X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-20 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113766X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-21 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113780X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-22 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113776X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-23 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113768X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-24 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113767X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-25 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113795X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-26 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113777X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-27 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113760X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-28 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113778X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-29 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113783X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-30 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113809X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-31 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113769X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-32 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113800X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-33 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113784X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-34 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113810X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-35 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113761X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-36 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113785X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-37 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113799X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-38 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113811X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-39 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113770X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-40 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113781X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-41 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113798X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-42 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113812X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-43 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113782X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-44 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113789X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-45 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113804X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-46 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113771X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-47 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113762X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-48 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113788X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-49 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113790X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-50 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113803X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-51 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113763X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-52 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113802X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-53 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113786X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-54 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113801X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-55 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113772X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-56 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113787X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-57 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113808X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-58 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113764X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-59 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113774X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-60 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113793X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-61 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113807X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-62 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113773X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-63 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113794X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-64 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113806X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-65 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113765X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-66 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113791X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-67 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113805X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-68 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113792X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation zhou-2008-69 human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113775X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions imex curation eif3l_human Eukaryotic translation initiation factor 3 subunit L EIF3L HSPC021 HSPC025 EIF3S6IP Eukaryotic translation initiation factor 3 subunit 6-interacting protein MSTP005 EIF3EIP Eukaryotic translation initiation factor 3 subunit E-interacting protein protein protein human Homo sapiens Human MSYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPSLEQRFESYYNYCNLFNYILNADGPAPLELPNQWLWDIIDEFIYQFQSFSQYRCKTAKKSEEEIDFLRSNPKIWNVHSVLNVLHSLVDKSNINRQLEVYTSGGDPESVAGEYGRHSLYKMLGYFSLVGLLRLHSLLGDYYQAIKVLENIELNKKSMYSRVPECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSMFQRTTYKYEMINKQNEQMHALLAIALTMYPMRIDESIHLQLREKYGDKMLRMQKGDPQVYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGISALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFEELNRTLKKMGQRP eif3m_human Eukaryotic translation initiation factor 3 subunit M EIF3M HFLB5 PCID1 PCI domain-containing protein 1 Fetal lung protein B5 GA17 PNAS-125 protein protein human Homo sapiens Human MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT eif3k_human Eukaryotic translation initiation factor 3 subunit K MSTP001 PTD001 HSPC029 EIF3K ARG134 EIF3S12 Eukaryotic translation initiation factor 3 subunit 12 eIF-3 p25 eIF-3 p28 Muscle-specific gene M9 protein PLAC-24 protein protein human Homo sapiens Human MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ eif3j_human Eukaryotic translation initiation factor 3 subunit J EIF3J PRO0391 EIF3S1 Eukaryotic translation initiation factor 3 subunit 1 eIF-3-alpha eIF3 p35 protein protein human Homo sapiens Human MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM eif3i_human Eukaryotic translation initiation factor 3 subunit I EIF3I TRIP1 EIF3S2 Eukaryotic translation initiation factor 3 subunit 2 eIF-3-beta eIF3 p36 TGF-beta receptor-interacting protein 1 protein protein human Homo sapiens Human MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFFDLRDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFEA eif3h_human Eukaryotic translation initiation factor 3 subunit H EIF3S3 Eukaryotic translation initiation factor 3 subunit 3 eIF-3-gamma eIF3 p40 subunit EIF3H protein protein human Homo sapiens Human MASRKEGTGSTATSSSSTAGAAGKGKGKGGSGDSAVKQVQIDGLVVLKIIKHYQEEGQGTEVVQGVLLGLVVEDRLEITNCFPFPQHTEDDADFDEVQYQMEMMRSLRHVNIDHLHVGWYQSTYYGSFVTRALLDSQFSYQHAIEESVVLIYDPIKTAQGSLSLKAYRLTPKLMEVCKEKDFSPEALKKANITFEYMFEEVPIVIKNSHLINVLMWELEKKSAVADKHELLSLASSNHLGKNLQLLMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN eif3g_human Eukaryotic translation initiation factor 3 subunit G EIF3G EIF3S4 Eukaryotic translation initiation factor 3 subunit 4 eIF-3-delta Eukaryotic translation initiation factor 3 RNA-binding subunit eIF3 p44 eIF3 p42 protein protein human Homo sapiens Human MPTGDFDSKPSWADQVEEEGEDDKCVTSELLKGIPLATGDTSPEPELLPGAPLPPPKEVINGNIKTVTEYKIDEDGKKFKIVRTFRIETRKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVSMTFITSKEDLNCQEEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSTN eif3f_human Eukaryotic translation initiation factor 3 subunit F Eukaryotic translation initiation factor 3 subunit 5 eIF-3-epsilon eIF3 p47 EIF3F EIF3S5 Deubiquitinating enzyme eIF3f protein protein human Homo sapiens Human MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL eif3e_human Eukaryotic translation initiation factor 3 subunit E EIF3E INT6 EIF3S6 Eukaryotic translation initiation factor 3 subunit 6 eIF-3 p48 Viral integration site protein INT-6 homolog protein protein human Homo sapiens Human MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY eif3d_human Eukaryotic translation initiation factor 3 subunit D EIF3D EIF3S7 Eukaryotic translation initiation factor 3 subunit 7 eIF-3-zeta eIF3 p66 protein protein human Homo sapiens Human MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHEEDESSFQLVDTARTQKTAYQRNRMRFAQRNLRRDKDRRNMLQFNLQILPKSAKQKERERIRLQKKFQKQFGVRQKWDQKSQKPRDSSVEVRSDWEVKEEMDFPQLMKMRYLEVSEPQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFHTVTTTDDPVIRKLAKTQGNVFATDAILATLMSCTRSVYSWDIVVQRVGSKLFFDKRDNSDFDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDEDEEEEEEEEEEEEEEET eif3c_human Eukaryotic translation initiation factor 3 subunit C EIF3C EIF3S8 Eukaryotic translation initiation factor 3 subunit 8 eIF3 p110 protein protein human Homo sapiens Human MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNELWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITSYKQNPEQSADEDAEKNEEDSEGSSDEDEDEDGVSAATFLKKKSEAPSGESRKFLKKMDDEDEDSEDSEDDEDWDTGSTSSDSDSEEEEGKQTALASRFLKKAPTTDEDKKAAEKKREDKAKKKHDRKSKRLDEEEEDNEGGEWERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLATYMKPEMWGKCLDCINELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKGTTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTYGGYFRDQKDGYRKNEGYMRRGGYRQQQSQTAY eif3b_human Eukaryotic translation initiation factor 3 subunit B Eukaryotic translation initiation factor 3 subunit 9 eIF-3-eta eIF3 p116 eIF3 p110 Prt1 homolog EIF3B EIF3S9 protein protein human Homo sapiens Human MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEAAGTEASSEEVGIAEAGPESEVRTEPAAEAEAASGPSESPSPPAAEELPGSHAEPPVPAQGEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLATFHQRGIALWGGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHCESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMKETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIPLGNQE eif3a_human Eukaryotic translation initiation factor 3 subunit A EIF3A KIAA0139 EIF3S10 Eukaryotic translation initiation factor 3 subunit 10 eIF-3-theta eIF3 p167 eIF3 p180 eIF3 p185 protein protein human Homo sapiens Human MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKMAEEKTEAAKEESQQMVLDIEDLDNIQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQAFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLYHLSREMRKNLTQDEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLGLQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEKEPELQQYVPQLQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDLQVRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPAHILQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAELQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIEDLEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRIKDMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQSVYEEKLKQFEERLAEERHNRLEERKRQRKEERRITYYREKEEEEQRRAEEQMLKEREERERAERAKREEELREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDSSLSRKDSRWGDRDSEGTWRKGPEADSEWRRGPPEKEWRRGEGRDEDRSHRRDEERPRRLGDDEDREPSLRPDDDRVPRRGMDDDRGPRRGPEEDRFSRRGADDDRPSWRNTDDDRPPRRIADEDRGNWRHADDDRPPRRGLDEDRGSWRTADEDRGPRRGMDDDRGPRRGGADDERSSWRNADDDRGPRRGLDDDRGPRRGMDDDRGPRRGMDDDRGPRRGMDDDRGPRRGLDDDRGPWRNADDDRIPRRGAEDDRGPWRNMDDDRLSRRADDDRFPRRGDDSRPGPWRPLVKPGGWREKEKAREESWGPPRESRPSEEREWDREKERDRDNQDREENDKDPERERDRERDVDREDRFRRPRDEGGWRRGPAEESSSWRDSSRRDDRDRDDRRRERDDRRDLRERRDLRDDRDRRGPPLRSEREEVSSWRRADDRKDDRVEERDPPRRVPPPALSRDRERDRDREREGEKEKASWRAEKDRESLRRTKNETDEDGWTTVRR if5_yeast Eukaryotic translation initiation factor 5 YP3085.05 YPR041W TIF5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSINICRDNHDPFYRYKMPPIQAKVEGRGNGIKTAVLNVADISHALNRPAPYIVKYFGFELGAQTSISVDKDRYLVNGVHEPAKLQDVLDGFINKFVLCGSCKNPETEIIITKDNDLVRDCKACGKRTPMDLRHKLSSFILKNPPDSVSGSKKKKKAATASANVRGGGLSISDIAQGKSQNAPSDGTGSSTPQHHDEDEDELSRQIKAAASTLEDIEVKDDEWAVDMSEEAIRARAKELEVNSELTQLDEYGEWILEQAGEDKENLPSDVELYKKAAELDVLNDPKIGCVLAQCLFDEDIVNEIAEHNAFFTKILVTPEYEKNFMGGIERFLGLEHKDLIPLLPKILVQLYNNDIISEEEIMRFGTKSSKKFVPKEVSKKVRRAAKPFITWLETAESDDDEEDDE 1A1DA563B4ED1B1F eif3i_yeast Eukaryotic translation initiation factor 3 subunit I TIF34 YMR146C YM9375.16C Eukaryotic translation initiation factor 3 39 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MKAIKLTGHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYCVTGSADYSIKLWDVSNGQCVATWKSPVPVKRVEFSPCGNYFLAILDNVMKNPGSINIYEIERDSATHELTKVSEEPIHKIITHEGLDAATVAGWSTKGKYIIAGHKDGKISKYDVSNNYEYVDSIDLHEKSISDMQFSPDLTYFITSSRDTNSFLVDVSTLQVLKKYETDCPLNTAVITPLKEFIILGGGQEAKDVTTTSANEGKFEARFYHKIFEEEIGRVQGHFGPLNTVAISPQGTSYASGGEDGFIRLHHFEKSYFDFKYDVEKAAEAKEHMQEAN E6C0D0B275E87622 eif3g_yeast Eukaryotic translation initiation factor 3 subunit G TIF35 YDR429C D9461.16 Eukaryotic translation initiation factor 3 RNA-binding subunit Translation initiation factor eIF3 p33 subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEVAPEEIIENADGSRSIITYKIEDGVKYKITQKVKEVKVLEKVHKSVAERKNWHKYGSEKGSPAGPSAVTARLGEEVELRLSRNWKQAEEERIQKEKASLTKTGLQCRLCGNDHMTMNCPFKTILSELSALEDPATNEGGVEAASEEKAGQVGGAGSIPGQYVPPSRRAGARDPSSDAYRDSRERDDMCTLKIMQVNENADENSLREELLFPFAPIPRVSVVRNKETGKSRGLAFVTFSSEEVAEQALRFLDGRGYMNLILRVEWSKPKVKE 340A5285F2C84E06 eif3c_yeast Eukaryotic translation initiation factor 3 subunit C NIP1 YMR309C YM9924.01C YM9952.11C Eukaryotic translation initiation factor 3 93 kDa subunit Nuclear transport protein NIP1 Translation initiation factor eIF3, p93 subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRFFSSNYEYDVASSSSEEDLLSSSEEDLLSSSSSESELDQESDDSFFNESESESEADVDSDDSDAKPYGPDWFKKSEFRKQGGGSNKFLKSSNYDSSDEESDEEDGKKVVKSAKEKLLDEMQDVYNKISQAENSDDWLTISNEFDLISRLLVRAQQQNWGTPNIFIKVVAQVEDAVNNTQQADLKNKAVARAYNTTKQRVKKVSRENEDSMAKFRNDPESFDKEPTADLDISANGFTISSSQGNDQAVQEDFFTRLQTIIDSRGKKTVNQQSLISTLEELLTVAEKPYEFIMAYLTLIPSRFDASANLSYQPIDQWKSSFNDISKLLSILDQTIDTYQVNEFADPIDFIEDEPKEDSDGVKRILGSIFSFVERLDDEFMKSLLNIDPHSSDYLIRLRDEQSIYNLILRTQLYFEATLKDEHDLERALTRPFVKRLDHIYYKSENLIKIMETAAWNIIPAQFKSKFTSKDQLDSADYVDNLIDGLSTILSKQNNIAVQKRAILYNIYYTALNKDFQTAKDMLLTSQVQTNINQFDSSLQILFNRVVVQLGLSAFKLCLIEECHQILNDLLSSSHLREILGQQSLHRISLNSSNNASADERARQCLPYHQHINLDLIDVVFLTCSLLIEIPRMTAFYSGIKVKRIPYSPKSIRRSLEHYDKLSFQGPPETLRDYVLFAAKSMQKGNWRDSVKYLREIKSWALLPNMETVLNSLTERVQVESLKTYFFSFKRFYSSFSVAKLAELFDLPENKVVEVLQSVIAELEIPAKLNDEKTIFVVEKGDEITKLEEAMVKLNKEYKIAKERLNPPSNRR EE05097C44C45A4C eif3b_yeast Eukaryotic translation initiation factor 3 subunit B YOR361C PRT1 CDC63 Eukaryotic translation initiation factor 3 90 kDa subunit Translation initiation factor eIF3 p90 subunit Cell cycle regulation and translation initiation protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MKNFLPRTLKNIYELYFNNISVHSIVSRNTQLKRSKIIQMTTETFEDIKLEDIPVDDIDFSDLEEQYKVTEEFNFDQYIVVNGAPVIPSAKVPVLKKALTSLFSKAGKVVNMEFPIDEATGKTKGFLFVECGSMNDAKKIIKSFHGKRLDLKHRLFLYTMKDVERYNSDDFDTEFREPDMPTFVPSSSLKSWLMDDKVRDQFVLQDDVKTSVFWNSMFNEEDSLVESRENWSTNYVRFSPKGTYLFSYHQQGVTAWGGPNFDRLRRFYHPDVRNSSVSPNEKYLVTFSTEPIIVEEDNEFSPFTKKNEGHQLCIWDIASGLLMATFPVIKSPYLKWPLVRWSYNDKYCARMVGDSLIVHDATKNFMPLEAKALKPSGIRDFSFAPEGVKLQPFRNGDEPSVLLAYWTPETNNSACTATIAEVPRGRVLKTVNLVQVSNVTLHWQNQAEFLCFNVERHTKSGKTQFSNLQICRLTERDIPVEKVELKDSVFEFGWEPHGNRFVTISVHEVADMNYAIPANTIRFYAPETKEKTDVIKRWSLVKEIPKTFANTVSWSPAGRFVVVGALVGPNMRRSDLQFYDMDYPGEKNINDNNDVSASLKDVAHPTYSAATNITWDPSGRYVTAWSSSLKHKVEHGYKIFNIAGNLVKEDIIAGFKNFAWRPRPASILSNAERKKVRKNLREWSAQFEEQDAMEADTAMRDLILHQRELLKQWTEYREKIGQEMEKSMNFKIFDVQPEDASDDFTTIEEIVEEVLEETKEKVE F5E4E783408EE948 eif3a_yeast Eukaryotic translation initiation factor 3 subunit A RPG1 TIF32 YBR079C YBR0734 Eukaryotic translation initiation factor 3 110 kDa subunit homolog Translation initiation factor eIF3, p110 subunit homolog protein protein yeast Saccharomyces cerevisiae Baker's yeast MAPPPFRPENAIKRADELISVGEKQAALQSLHDFITARRIRWATPSTVEPVVFKFLEIGVELKKGKLLKDGLHQYKKLIQGSTEGLVSVGAVARKFIDLVESKIASEQTRADELQKQEIDDDLEGGVTPENLLISVYESDQSVAGFNDEAITSWLRFTWESYRAVLDLLRNNALLEITYSGVVKKTMHFCLKYQRKNEFKRLAEMLRQHLDAANYQQSKSGNNLVDLSDADTLQRYLDQRFQQVDVSVKLELWHEAYRSIEDVFHLMKISKRAPKPSTLANYYENLVKVFFVSGDPLLHTTAWKKFYKLYSTNPRATEEEFKTYSSTIFLSAISTQLDEIPSIGYDPHLRMYRLLNLDAKPTRKEMLQSIIEDESIYGKVDEELKELYDIIEVNFDVDTVKQQLENLLVKLSSKTYFSQYIAPLRDVIMRRVFVAASQKFTTVSQSELYKLATLPAPLDLSAWDIEKSLLQAAVEDYVSITIDHESAKVTFAKDPFDIFASTASKEVSEEENTEPEVQEEKEETDEALGPQETEDGEEKEEESDPVIIRNSYIHNKLLELSNVLHDVDSFNNASYMEKVRIARETLIKKNKDDLEKISKIVDERVKRSQEQKQKHMEHAALHAEQDAEVRQQRILEEKAAIEAKLEEEAHRRLIEKKKREFEAIKEREITKMITEVNAKGHVYIDPNEAKSLDLDTIKQVIIAEVSKNKSELESRMEYAMKKLDHTERALRKVELPLLQKEVDKLQETDTANYEAMKKKIVDAAKAEYEARMADRKNLVMVYDDYLKFKEHVSGTKESELAAIRNQKKAELEAAKKARIEEVRKRRYEEAIARRKEEIANAERQKRAQELAEATRKQREIEEAAAKKSTPYSFRAGNREPPSTPSTLPKATVSPDKAKLDMIAQKQREMEEAIEQRLAGRTAGGSSPATPATPATPATPTPSSGPKKMTMAEKLRAKRLAKGGR 93EFFA6B2FC8286D eif3a-eif3b-3 3173864 N/A 3173919 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173920 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173921 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173922 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173923 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173924 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173925 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173926 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173927 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173928 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173929 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173930 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173931 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false eif3l-eif3e-1 3173865 N/A 3173919 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173921 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173927 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association false false false eif3g-eif3i-1 3173866 N/A 3173923 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173925 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false yeif3a-yeif3b-1 3173867 N/A 3173932 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173933 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173934 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173935 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173936 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173937 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false yeif3c-yeif3a-1 3173868 N/A 3173932 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173933 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173934 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173935 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173936 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173937 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false eif3c-eif3d-1 3173869 N/A 3173919 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173921 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173927 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173928 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173929 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false eif3b-eif3g-1 3173870 N/A 3173925 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173930 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false eif3d-eif3e-1 3173871 N/A 3173919 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173927 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173928 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false eif3a-eif3b-4 3173872 N/A 3173923 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173925 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173927 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173930 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173931 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false eif3a-eif3b-5 3173873 N/A 3173923 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173925 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173929 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173930 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173931 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false yeif3b-yeif3a-1 3173874 N/A 3173932 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173933 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173934 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173935 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173936 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173937 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false eif3d-eif3e-2 3173875 N/A 3173927 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173928 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false yeif3a-yeif3b-2 3173876 N/A 3173933 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173934 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173935 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173936 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173937 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false eif3b-eif3g-2 3173877 N/A 3173923 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173925 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173930 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false eif3h-eif3m-1 3173878 N/A 3173920 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173924 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false eif3m-eif3b-1 3173879 N/A 3173920 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173930 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false eif3c-eif3d-2 3173880 N/A 3173919 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173921 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173923 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173925 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173927 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173928 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173929 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false eif3b-eif3f-1 3173881 N/A 3173926 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173930 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false eif3f-eif3m-5 3173882 N/A 3173920 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173926 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false eif3h-eif3f-1 3173883 N/A 3173920 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173926 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173924 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association false false false eif3b-eif3c-1 3173884 N/A 3173919 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173920 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173921 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173923 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173924 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173925 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173926 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173927 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173928 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173929 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173930 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false eif3e-eif3k-1 3173885 N/A 3173919 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173921 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173927 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false eif3e-eif3b-1 3173886 N/A 3173927 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173930 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false eif3m-eif3f-3 3173887 N/A 3173920 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173926 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false eif3c-eif3d-3 3173888 N/A 3173919 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173920 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173924 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173926 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173927 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173928 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173929 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false eif3f-eif3h-1 3173889 N/A 3173920 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173924 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173926 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false eif3b-eif3e-1 3173890 N/A 3173927 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173930 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false eif3k-eif3e-1 3173891 N/A 3173921 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173927 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false eif3f-eif3h-2 3173892 N/A 3173924 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173926 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false yeif3b-yeif3g-1 3173893 N/A 3173933 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173934 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173936 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false eif3b-eif3k-1 3173894 N/A 3173921 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173930 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false eif3c-eif3d-4 3173895 N/A 3173919 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173924 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173926 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173927 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173928 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173929 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false eif3b-eif3c-2 3173896 N/A 3173920 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173923 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173924 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173925 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173926 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173927 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173928 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173929 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173930 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false yeif3a-yeif3b-3 3173897 N/A 3173936 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173937 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false yeif3g-yeif3i-1 3173898 N/A 3173933 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173934 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false eif3h-eif3b-1 3173899 N/A 3173924 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173930 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false eif3c-eif3d-5 3173900 N/A 3173919 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173920 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173921 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173924 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173926 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173927 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173928 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173929 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false eif3b-eif3h-1 3173901 N/A 3173924 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173930 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false eif3k-eif3l-1 3173902 N/A 3173919 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173921 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false eif3f-eif3b-1 3173903 N/A 3173926 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173930 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false eif3c-eif3d-6 3173904 N/A 3173919 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173924 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173927 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173928 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173929 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false eif3e-eif3l-1 3173905 N/A 3173919 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173927 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false eif3b-eif3m-1 3173906 N/A 3173920 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173930 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false eif3c-eif3d-7 3173907 N/A 3173919 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173921 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173924 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173926 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173927 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173928 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173929 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false eif3c-eif3e-1 3173908 N/A 3173919 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173921 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173927 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173929 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false yeif3b-yeif3g-2 3173909 N/A 3173934 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173936 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false eif3l-eif3b-1 3173910 N/A 3173919 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173930 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false eif3c-eif3d-8 3173911 N/A 3173919 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173927 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173928 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173929 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false yeif3b-yeif3c-1 3173912 N/A 3173934 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173935 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173936 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false eif3b-eif3l-1 3173913 N/A 3173919 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173930 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false eif3c-eif3d-9 3173914 N/A 3173919 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173921 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173924 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173927 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173928 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173929 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false yeif3b-yeif3c-2 3173915 N/A 3173933 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173935 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173936 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false eif3k-eif3b-1 3173916 N/A 3173921 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173930 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false yeif3b-yeif3i-1 3173917 N/A 3173933 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3173936 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false eif3d-eif3e-3 3173918 N/A 3173919 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173921 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173927 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3173928 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false