DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ jones-2008-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Jones BC., Logsdon NJ., Walter MR. DIP original experiment: DIP-110820X Structure (London, England : 1993) 2008 IMEx Structure of IL-22 bound to its high-affinity IL-22R1 chain. Jones BC., Logsdon NJ., Walter MR. Only protein-protein interactions imex curation jones-2008-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Jones BC., Logsdon NJ., Walter MR. DIP original experiment: DIP-110823X Structure (London, England : 1993) 2008 IMEx Structure of IL-22 bound to its high-affinity IL-22R1 chain. Jones BC., Logsdon NJ., Walter MR. Only protein-protein interactions imex curation jones-2008-3 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Jones BC., Logsdon NJ., Walter MR. DIP original experiment: DIP-110821X Structure (London, England : 1993) 2008 IMEx Structure of IL-22 bound to its high-affinity IL-22R1 chain. Jones BC., Logsdon NJ., Walter MR. Only protein-protein interactions imex curation jones-2008-4 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Jones BC., Logsdon NJ., Walter MR. DIP original experiment: DIP-110822X Structure (London, England : 1993) 2008 IMEx Structure of IL-22 bound to its high-affinity IL-22R1 chain. Jones BC., Logsdon NJ., Walter MR. Only protein-protein interactions imex curation il22_human Interleukin-22 IL22 ILTIF UNQ3099/PRO10096 ZCYTO18 IL-10-related T-cell-derived-inducible factor Cytokine Zcyto18 protein protein human Homo sapiens Human MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI Cytokine that contributes to the inflammatory response in vivo mint i22r1_human Interleukin-22 receptor subunit alpha-1 IL22RA1 IL22R Cytokine receptor class-II member 9 Cytokine receptor family 2 member 9 ZcytoR11 protein protein human Homo sapiens Human MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWTYSFSGAFLFSMGFLVAVLCYLSYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVGPPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLSSPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWES q969j5-3 Interleukin-22 receptor subunit alpha-2 IL22RA2 Cytokine receptor class-II member 10 Cytokine receptor family 2 member 10 Cytokine receptor family type 2, soluble 1 Interleukin-22-binding protein ZcytoR16 UNQ5793/PRO19598/PRO19822 CRF2-10S protein protein human Homo sapiens Human MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWERAKGL q969j5-2 Interleukin-22 receptor subunit alpha-2 IL22RA2 Cytokine receptor class-II member 10 Cytokine receptor family 2 member 10 Cytokine receptor family type 2, soluble 1 Interleukin-22-binding protein ZcytoR16 UNQ5793/PRO19598/PRO19822 CRF2-10 CRF2-s1-short Short protein protein human Homo sapiens Human MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP il22-il22ra1-3 3173830 N/A 3173834 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3173835 unspecified role unspecified role unspecified role unspecified role Region 19-225 Region 19-225 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction false false false il22ra2-il22-1 3173831 N/A 3173834 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3173836 unspecified role unspecified role bait bait drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction false false false il22ra1-il22-1 3173832 N/A 3173834 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3173835 unspecified role unspecified role bait bait Region 19-225 Region 19-225 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction false false false il22ra2-il22-2 3173833 N/A 3173834 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3173837 unspecified role unspecified role bait bait drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction false false false