DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ gong-2008-1 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Gong Y., Cao P., Yu HJ., Jiang T. DIP original experiment: DIP-250350X Nature 2008 IMEx Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Gong Y., Cao P., Yu HJ., Jiang T. Only protein-protein interactions imex curation gong-2008-2 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Gong Y., Cao P., Yu HJ., Jiang T. DIP original experiment: DIP-250345X Nature 2008 IMEx Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Gong Y., Cao P., Yu HJ., Jiang T. Only protein-protein interactions imex curation gong-2008-3 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Gong Y., Cao P., Yu HJ., Jiang T. DIP original experiment: DIP-250348X Nature 2008 IMEx Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Gong Y., Cao P., Yu HJ., Jiang T. Only protein-protein interactions imex curation gong-2008-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Gong Y., Cao P., Yu HJ., Jiang T. DIP original experiment: DIP-250346X Nature 2008 IMEx Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Gong Y., Cao P., Yu HJ., Jiang T. Only protein-protein interactions imex curation gong-2008-5 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Gong Y., Cao P., Yu HJ., Jiang T. DIP original experiment: DIP-250349X Nature 2008 IMEx Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Gong Y., Cao P., Yu HJ., Jiang T. Only protein-protein interactions imex curation gong-2008-6 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Gong Y., Cao P., Yu HJ., Jiang T. DIP original experiment: DIP-250351X Nature 2008 IMEx Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Gong Y., Cao P., Yu HJ., Jiang T. Only protein-protein interactions imex curation gong-2008-7 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Gong Y., Cao P., Yu HJ., Jiang T. DIP original experiment: DIP-250347X Nature 2008 IMEx Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Gong Y., Cao P., Yu HJ., Jiang T. Only protein-protein interactions imex curation tnr16_rat Tumor necrosis factor receptor superfamily member 16 Ngfr Tnfrsf16 Low-affinity nerve growth factor receptor Gp80-LNGFR p75 ICD Low affinity neurotrophin receptor p75NTR protein protein rat Rattus norvegicus (Rat) Rat MRRAGAACSAMDRLRLLLLLILGVSSGGAKETCSTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDNVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCAYGYYQDEETGHCEACSVCEVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQLRECTPWADAECEEIPGRWIPRSTPPEGSDSTAPSTQEPEVPPEQDLVPSTVADMVTTVMGSSQPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSESTATSPV ngf_human Beta-nerve growth factor NGF NGFB protein protein human Homo sapiens Human MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA ntf3_human Neurotrophin-3 Neurotrophic factor HDNF Nerve growth factor 2 NTF3 protein protein human Homo sapiens Human MSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLMEDYVGSPVVANRTSRRKRYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRT ngf_mouse Beta-nerve growth factor Ngf Ngfb protein protein mouse Mus musculus Mouse MSMLFYTLITAFLIGVQAEPYTDSNVPEGDSVPEAHWTKLQHSLDTALRRARSAPTAPIAARVTGQTRNITVDPRLFKKRRLHSPRVLFSTQPPPTSSDTLDLDFQAHGTIPFNRTHRSKRSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG ngf-ngfr-1 3173792 N/A 3173799 unspecified role unspecified role unspecified role unspecified role Region 1-161 Region 1-161 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173800 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ngfr-6 3173793 N/A 3173799 unspecified role unspecified role unspecified role unspecified role Region 1-161 Region 1-161 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false ntf3-ngfr-1 3173794 N/A 3173799 unspecified role unspecified role prey prey Region 1-161 Region 1-161 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173801 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction false false false ngfr-ntf3-1 3173795 N/A 3173799 unspecified role unspecified role unspecified role unspecified role Region 1-161 Region 1-161 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173801 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ngfr-ntf3-2 3173796 N/A 3173799 unspecified role unspecified role unspecified role unspecified role Region 1-161 Region 1-161 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173801 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ngf-ngfr-2 3173797 N/A 3173802 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse N/A 3173799 unspecified role unspecified role unspecified role unspecified role Region 1-161 Region 1-161 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false ngfr-ntf3-3 3173798 N/A 3173799 unspecified role unspecified role unspecified role unspecified role Region 1-161 Region 1-161 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3173801 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false