DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ okada-2008-5 in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Okada M., Jang SW., Ye K. DIP original experiment: DIP-111150X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Akt phosphorylation and nuclear phosphoinositide association mediate mRNA export and cell proliferation activities by ALY. Okada M., Jang SW., Ye K. Only protein-protein interactions imex curation okada-2008-6 human Homo sapiens Human pull down pull down predetermined predetermined participant predetermined Okada M., Jang SW., Ye K. DIP original experiment: DIP-111152X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Akt phosphorylation and nuclear phosphoinositide association mediate mRNA export and cell proliferation activities by ALY. Okada M., Jang SW., Ye K. Only protein-protein interactions imex curation okada-2008-7 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Okada M., Jang SW., Ye K. DIP original experiment: DIP-111154X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Akt phosphorylation and nuclear phosphoinositide association mediate mRNA export and cell proliferation activities by ALY. Okada M., Jang SW., Ye K. Only protein-protein interactions imex curation okada-2008-8 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Okada M., Jang SW., Ye K. DIP original experiment: DIP-111153X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Akt phosphorylation and nuclear phosphoinositide association mediate mRNA export and cell proliferation activities by ALY. Okada M., Jang SW., Ye K. Only protein-protein interactions imex curation okada-2008-9 human Homo sapiens Human pull down pull down predetermined predetermined participant predetermined Okada M., Jang SW., Ye K. DIP original experiment: DIP-111151X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Akt phosphorylation and nuclear phosphoinositide association mediate mRNA export and cell proliferation activities by ALY. Okada M., Jang SW., Ye K. Only protein-protein interactions imex curation thoc4_human THO complex subunit 4 ALYREF ALY Ally of AML-1 and LEF-1 Aly/REF export factor BEF THOC4 Transcriptional coactivator Aly/REF bZIP-enhancing factor BEF protein protein human Homo sapiens Human MADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAYNARMDTS akt1_human RAC-alpha serine/threonine-protein kinase AKT1 PKB RAC RAC-PK-alpha Protein kinase B Proto-oncogene c-Akt Protein kinase B alpha protein protein human Homo sapiens Human MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA akt1-alyref-1 3173409 N/A 3173414 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 1-107 Region 1-107 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 181-257 Region 181-257 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q86V81:p.Ser34Ala S34A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q86V81:p.Thr219Ala T219A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3173415 enzyme enzyme unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false alyref-akt1-1 3173410 N/A 3173414 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3173415 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false alyref-akt1-2 3173411 N/A 3173414 unspecified role unspecified role bait bait Region 1-107 Region 1-107 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 181-257 Region 181-257 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q86V81:p.Thr219Ala T219A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3173415 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false akt1-alyref-2 3173412 N/A 3173414 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3173415 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false alyref-akt1-3 3173413 N/A 3173414 unspecified role unspecified role bait bait Q86V81:p.Thr219Ala T219A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3173415 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false