DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ liang-2008-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight identificat confirmation by molecular weight weight identificat Liang S., Ristich V., Arase H., Dausset J., Carosella ED., Horuzsko A. DIP original experiment: DIP-111123X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Modulation of dendritic cell differentiation by HLA-G and ILT4 requires the IL-6--STAT3 signaling pathway. Liang S., Ristich V., Arase H., Dausset J., Carosella ED., Horuzsko A. Only protein-protein interactions imex curation liang-2008-3 in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel monoclonal western monoclonal antibody western blot monoclonal western Liang S., Ristich V., Arase H., Dausset J., Carosella ED., Horuzsko A. DIP original experiment: DIP-111124X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Modulation of dendritic cell differentiation by HLA-G and ILT4 requires the IL-6--STAT3 signaling pathway. Liang S., Ristich V., Arase H., Dausset J., Carosella ED., Horuzsko A. Only protein-protein interactions imex curation liang-2008-4 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liang S., Ristich V., Arase H., Dausset J., Carosella ED., Horuzsko A. DIP original experiment: DIP-111125X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Modulation of dendritic cell differentiation by HLA-G and ILT4 requires the IL-6--STAT3 signaling pathway. Liang S., Ristich V., Arase H., Dausset J., Carosella ED., Horuzsko A. Only protein-protein interactions imex curation liang-2008-5 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liang S., Ristich V., Arase H., Dausset J., Carosella ED., Horuzsko A. DIP original experiment: DIP-111126X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Modulation of dendritic cell differentiation by HLA-G and ILT4 requires the IL-6--STAT3 signaling pathway. Liang S., Ristich V., Arase H., Dausset J., Carosella ED., Horuzsko A. Only protein-protein interactions imex curation hlag_human HLA class I histocompatibility antigen, alpha chain G HLAG HLA-G HLA-6.0 HLA G antigen MHC class I antigen G protein protein human Homo sapiens Human MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD ptn6_mouse Tyrosine-protein phosphatase non-receptor type 6 Ptpn6 Hcp Hcph Ptp1C Protein-tyrosine phosphatase 1C Hematopoietic cell protein-tyrosine phosphatase 70Z-SHP SH-PTP1 PTPTY-42 protein protein mouse Mus musculus Mouse MVRWFHRDLSGPDAETLLKGRGVPGSFLARPSRKNQGDFSLSVRVDDQVTHIRIQNSGDFYDLYGGEKFATLTELVEYYTQQQGILQDRDGTIIHLKYPLNCSDPTSERWYHGHISGGQAESLLQAKGEPWTFLVRESLSQPGDFVLSVLNDQPKAGPGSPLRVTHIKVMCEGGRYTVGGSETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTAKAGFWEEFESLQKQEVKNLHQRLEGQRPENKSKNRYKNILPFDHSRVILQGRDSNIPGSDYINANYVKNQLLGPDENSKTYIASQGCLDATVNDFWQMAWQENTRVIVMTTREVEKGRNKCVPYWPEVGTQRVYGLYSVTNSREHDTAEYKLRTLQISPLDNGDLVREIWHYQYLSWPDHGVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMESISTKGLDCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEIIQSQKGQESEYGNITYPPAVRSAHAKASRTSSKHKEEVYENVHSKSKKEEKVKKQRSADKEKNKGSLKRK lirb4_mouse Leukocyte immunoglobulin-like receptor subfamily B member 4 Lilrb4 Gp49b Mast cell surface glycoprotein Gp49B protein protein mouse Mus musculus Mouse MIAMLTVLLYLGLILEPRTAVQAGHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQKILIGVLVSFLLLFFLLLFLILIGYQYGHKKKANASVKNTQSENNAELNSWNPQNEDPQGIVYAQVKPSRLQKDTACKETQDVTYAQLCIRTQEQNNS ptn11_mouse Tyrosine-protein phosphatase non-receptor type 11 Ptpn11 Protein-tyrosine phosphatase SYP SH-PTP2 protein protein mouse Mus musculus Mouse MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETTDKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEPVSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEVERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIVDAGPVVVHCSAGIGRTGTFIVIDILIDIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGHEYTNIKYSLVDQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQRSFR hla_g-9 3173050 N/A 3173054 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false hla_g-10 3173051 N/A 3173054 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false lilrb4-ptpn6-4 3173052 N/A 3173055 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3173056 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false lilrb4-ptpn11-1 3173053 N/A 3173057 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3173056 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false