DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wang-2008-48 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wang X., Weldeghiorghis T., Zhang G., Imperiali B., Prestegard JH. DIP original experiment: DIP-110775X Structure (London, England : 1993) 2008 IMEx Solution structure of Alg13: the sugar donor subunit of a yeast N-acetylglucosamine transferase. Wang X., Weldeghiorghis T., Zhang G., Imperiali B., Prestegard JH. Only protein-protein interactions imex curation wang-2008-49 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Wang X., Weldeghiorghis T., Zhang G., Imperiali B., Prestegard JH. DIP original experiment: DIP-110776X Structure (London, England : 1993) 2008 IMEx Solution structure of Alg13: the sugar donor subunit of a yeast N-acetylglucosamine transferase. Wang X., Weldeghiorghis T., Zhang G., Imperiali B., Prestegard JH. Only protein-protein interactions imex curation alg13_yeast UDP-N-acetylglucosamine transferase subunit ALG13 YGL047W ALG13 Asparagine-linked glycosylation protein 13 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGIIEEKALFVTCGATVPFPKLVSCVLSDEFCQELIQYGFVRLIIQFGRNYSSEFEHLVQERGGQRESQKIPIDQFGCGDTARQYVLMNGKLKVIGFDFSTKMQSIIRDYSDLVISHAGTGSILDSLRLNKPLIVCVNDSLMDNHQQQIADKFVELGYVWSCAPTETGLIAGLRASQTEKLKPFPVSHNPSFERLLVETIYS 9D5CDB366BBC1ED0 alg13-1 3172916 N/A 3172918 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false alg13-2 3172917 N/A 3172918 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false