DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hsu-2008-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Hsu LC., Ali SR., McGillivray S., Tseng PH., Mariathasan S., Humke EW., Eckmann L., Powell JJ., Nizet V., Dixit VM., Karin M. DIP original experiment: DIP-111071X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A NOD2-NALP1 complex mediates caspase-1-dependent IL-1beta secretion in response to Bacillus anthracis infection and muramyl dipeptide. Hsu LC., Ali SR., McGillivray S., Tseng PH., Mariathasan S., Humke EW., Eckmann L., Powell JJ., Nizet V., Dixit VM., Karin M. Only protein-protein interactions imex curation hsu-2008-2 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hsu LC., Ali SR., McGillivray S., Tseng PH., Mariathasan S., Humke EW., Eckmann L., Powell JJ., Nizet V., Dixit VM., Karin M. DIP original experiment: DIP-111075X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A NOD2-NALP1 complex mediates caspase-1-dependent IL-1beta secretion in response to Bacillus anthracis infection and muramyl dipeptide. Hsu LC., Ali SR., McGillivray S., Tseng PH., Mariathasan S., Humke EW., Eckmann L., Powell JJ., Nizet V., Dixit VM., Karin M. Only protein-protein interactions imex curation hsu-2008-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hsu LC., Ali SR., McGillivray S., Tseng PH., Mariathasan S., Humke EW., Eckmann L., Powell JJ., Nizet V., Dixit VM., Karin M. DIP original experiment: DIP-111073X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A NOD2-NALP1 complex mediates caspase-1-dependent IL-1beta secretion in response to Bacillus anthracis infection and muramyl dipeptide. Hsu LC., Ali SR., McGillivray S., Tseng PH., Mariathasan S., Humke EW., Eckmann L., Powell JJ., Nizet V., Dixit VM., Karin M. Only protein-protein interactions imex curation hsu-2008-4 human Homo sapiens Human molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Hsu LC., Ali SR., McGillivray S., Tseng PH., Mariathasan S., Humke EW., Eckmann L., Powell JJ., Nizet V., Dixit VM., Karin M. DIP original experiment: DIP-111076X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A NOD2-NALP1 complex mediates caspase-1-dependent IL-1beta secretion in response to Bacillus anthracis infection and muramyl dipeptide. Hsu LC., Ali SR., McGillivray S., Tseng PH., Mariathasan S., Humke EW., Eckmann L., Powell JJ., Nizet V., Dixit VM., Karin M. Only protein-protein interactions imex curation hsu-2008-5 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hsu LC., Ali SR., McGillivray S., Tseng PH., Mariathasan S., Humke EW., Eckmann L., Powell JJ., Nizet V., Dixit VM., Karin M. DIP original experiment: DIP-111078X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A NOD2-NALP1 complex mediates caspase-1-dependent IL-1beta secretion in response to Bacillus anthracis infection and muramyl dipeptide. Hsu LC., Ali SR., McGillivray S., Tseng PH., Mariathasan S., Humke EW., Eckmann L., Powell JJ., Nizet V., Dixit VM., Karin M. Only protein-protein interactions imex curation hsu-2008-6 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hsu LC., Ali SR., McGillivray S., Tseng PH., Mariathasan S., Humke EW., Eckmann L., Powell JJ., Nizet V., Dixit VM., Karin M. DIP original experiment: DIP-111074X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A NOD2-NALP1 complex mediates caspase-1-dependent IL-1beta secretion in response to Bacillus anthracis infection and muramyl dipeptide. Hsu LC., Ali SR., McGillivray S., Tseng PH., Mariathasan S., Humke EW., Eckmann L., Powell JJ., Nizet V., Dixit VM., Karin M. Only protein-protein interactions imex curation hsu-2008-7 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hsu LC., Ali SR., McGillivray S., Tseng PH., Mariathasan S., Humke EW., Eckmann L., Powell JJ., Nizet V., Dixit VM., Karin M. DIP original experiment: DIP-111072X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A NOD2-NALP1 complex mediates caspase-1-dependent IL-1beta secretion in response to Bacillus anthracis infection and muramyl dipeptide. Hsu LC., Ali SR., McGillivray S., Tseng PH., Mariathasan S., Humke EW., Eckmann L., Powell JJ., Nizet V., Dixit VM., Karin M. Only protein-protein interactions imex curation hsu-2008-8 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hsu LC., Ali SR., McGillivray S., Tseng PH., Mariathasan S., Humke EW., Eckmann L., Powell JJ., Nizet V., Dixit VM., Karin M. DIP original experiment: DIP-111077X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A NOD2-NALP1 complex mediates caspase-1-dependent IL-1beta secretion in response to Bacillus anthracis infection and muramyl dipeptide. Hsu LC., Ali SR., McGillivray S., Tseng PH., Mariathasan S., Humke EW., Eckmann L., Powell JJ., Nizet V., Dixit VM., Karin M. Only protein-protein interactions imex curation casp1_mouse Caspase-1 Interleukin-1 beta convertase Interleukin-1 beta-converting enzyme p45 Casp1 Il1bc protein protein mouse Mus musculus Mouse MADKILRAKRKQFINSVSIGTINGLLDELLEKRVLNQEEMDKIKLANITAMDKARDLCDHVSKKGPQASQIFITYICNEDCYLAGILELQSAPSAETFVATEDSKGGHPSSSETKEEQNKEDGTFPGLTGTLKFCPLEKAQKLWKENPSEIYPIMNTTTRTRLALIICNTEFQHLSPRVGAQVDLREMKLLLEDLGYTVKVKENLTALEMVKEVKEFAACPEHKTSDSTFLVFMSHGIQEGICGTTYSNEVSDILKVDTIFQMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVRDSEEDFLTDAIFEDDGIKKAHIEKDFIAFCSSTPDNVSWRHPVRGSLFIESLIKHMKEYAWSCDLEDIFRKVRFSFEQPEFRLQMPTADRVTLTKRFYLFPGH nod2_mouse Nucleotide-binding oligomerization domain-containing protein 2 Nod2 Card15 Caspase recruitment domain-containing protein 15 protein protein mouse Mus musculus Mouse MRSSCCDMCSQEEFQAQRSQLVALLISGSLEGFESILDWLLSWDVLSREDYEGLSLPGQPLSHSARRLLDTVWNKGVWGCQKLLEAVQEAQANSHTFELYGSWDTHSLHPTRDLQSHRPAIVRRLYNHVEAMLELAREGGFLSQYECEEIRLPIFTSSQRARRLLDLAAVKANGLAAFLLQHVRELPAPLPLPYEAAECQKFISKLRTMVLTQSRFLSTYDGSENLCLEDIYTENILELQTEVGTAGALQKSPAILGLEDLFDTHGHLNRDADTILVVGEAGSGKSTLLQRLHLLWATGRSFQEFLFIFPFSCRQLQCVAKPLSLRTLLFEHCCWPDVAQDDVFQFLLDHPDRVLLTFDGLDEFKFRFTDRERHCSPIDPTSVQTLLFNLLQGNLLKNACKVLTSRPDAVSALLRKFVRTELQLKGFSEEGIQLYLRKHHREPGVADRLIQLIQATSALHGLCHLPVFSWMVSRCHRELLLQNRGFPTTSTDMYLLILQHFLLHASPPDSSPLGLGPGLLQSRLSTLLHLGHLALRGLAMSCYVFSAQQLQAAQVDSDDISLGFLVRAQSSVPGSKAPLEFLHITFQCFFAAFYLAVSADTSVASLKHLFSCGRLGSSLLGRLLPNLCIQGSRVKKGSEAALLQKAEPHNLQITAAFLAGLLSQQHRDLLAACQVSERVLLQRQARARSCLAHSLREHFHSIPPAVPGETKSMHAMPGFIWLIRSLYEMQEEQLAQEAVRRLDIGHLKLTFCRVGPAECAALAFVLQHLQRPVALQLDYNSVGDVGVEQLRPCLGVCTALYLRDNNISDRGARTLVECALRCEQLQKLALFNNKLTDACACSMAKLLAHKQNFLSLRVGNNHITAAGAEVLAQGLKSNTSLKFLGFWGNSVGDKGTQALAEVVADHQNLKWLSLVGNNIGSMGAEALALMLEKNKSLEELCLEENHICDEGVYSLAEGLKRNSTLKFLKLSNNGITYRGAEALLQALSRNSAILEVWLRGNTFSLEEIQTLSSRDARLLL nod2_human Nucleotide-binding oligomerization domain-containing protein 2 IBD1 NOD2 CARD15 Caspase recruitment domain-containing protein 15 Inflammatory bowel disease protein 1 protein protein human Homo sapiens Human MGEEGGSASHDEEERASVLLGHSPGCEMCSQEAFQAQRSQLVELLVSGSLEGFESVLDWLLSWEVLSWEDYEGFHLLGQPLSHLARRLLDTVWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPIFTPSQRARRLLDLATVKANGLAAFLLQHVQELPVPLALPLEAATCKKYMAKLRTTVSAQSRFLSTYDGAETLCLEDIYTENVLEVWADVGMAGPPQKSPATLGLEELFSTPGHLNDDADTVLVVGEAGSGKSTLLQRLHLLWAAGQDFQEFLFVFPFSCRQLQCMAKPLSVRTLLFEHCCWPDVGQEDIFQLLLDHPDRVLLTFDGFDEFKFRFTDRERHCSPTDPTSVQTLLFNLLQGNLLKNARKVVTSRPAAVSAFLRKYIRTEFNLKGFSEQGIELYLRKRHHEPGVADRLIRLLQETSALHGLCHLPVFSWMVSKCHQELLLQEGGSPKTTTDMYLLILQHFLLHATPPDSASQGLGPSLLRGRLPTLLHLGRLALWGLGMCCYVFSAQQLQAAQVSPDDISLGFLVRAKGVVPGSTAPLEFLHITFQCFFAAFYLALSADVPPALLRHLFNCGRPGNSPMARLLPTMCIQASEGKDSSVAALLQKAEPHNLQITAAFLAGLLSREHWGLLAECQTSEKALLRRQACARWCLARSLRKHFHSIPPAAPGEAKSVHAMPGFIWLIRSLYEMQEERLARKAARGLNVGHLKLTFCSVGPTECAALAFVLQHLRRPVALQLDYNSVGDIGVEQLLPCLGVCKALYLRDNNISDRGICKLIECALHCEQLQKLALFNNKLTDGCAHSMAKLLACRQNFLALRLGNNYITAAGAQVLAEGLRGNTSLQFLGFWGNRVGDEGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALMLAKNVMLEELCLEENHLQDEGVCSLAEGLKKNSSLKILKLSNNCITYLGAEALLQALERNDTILEVWLRGNTFSLEEVDKLGCRDTRLLL mint homomint Induces NF-kappa-B via RICK (CARDIAK, RIP2) and IKK-gamma. Confers responsiveness to intracellular bacterial lipopolysaccharides (LPS) Defects in NOD2 are the cause of Blau syndrome (BS) [MIM:186580]. BS is a rare autosomal dominant disorder characterized by early-onset granulomatous arthritis, uveitis and skin rash Defects in NOD2 are a cause of susceptibility to Crohn disease (CD) [MIM:266600]. CD is a form of remitting inflammatory bowel disease (IBD). CD may involve any part of the gastrointestinal tract, but most frequently the terminal ileum and colon. Bowel inflammation is transmural and discontinuous. Crohn disease is commonly classified as autoimmune disease Defects in NOD2 are a cause of susceptibility to ulcerative colitis [MIM:191390]. It is a chronic inflammatory bowel disease. In ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers. Ulcerative colitis is commonly classified as autoimmune disease Defects in NOD2 are the cause of early-onset sarcoidosis (EOS) [MIM:609464]. Sarcoidosis is a multiorganic inflammatory disease with unknown etiology, characterized by the histologic features of non-caseating epithelioid granulomas. In childhood, 2 distinct types of sarcoidosis have been described. Usually the disease is detected in older children by chest radiography and the clinical manifestations are characterized by a classical triad of lung, lymph node, and eye involvement, similar to those in adults. In contrast, early-onset sarcoidosis (EOS), which usually appears in those younger than 4 years of age, is quite rare and has a distinct triad of skin, joint, and eye disorders, without apparent pulmonary involvement. Compared with an asymptomatic and sometimes naturally disappearing course of the disease in older children, EOS is progressive and in many cases causes severe complications, such as blindness, joint destruction, and visceral involvement casp1_human Caspase-1 Interleukin-1 beta convertase Interleukin-1 beta-converting enzyme p45 CASP1 IL1BC IL1BCE protein protein human Homo sapiens Human MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH casp4_human Caspase-4 ICH2 CASP4 Protease TX ICE(rel)-II ICE and Ced-3 homolog 2 Mih1 protein protein human Homo sapiens Human MAEGNHRKKPLKVLESLGKDFLTGVLDNLVEQNVLNWKEEEKKKYYDAKTEDKVRVMADSMQEKQRMAGQMLLQTFFNIDQISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKERAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDITGMKELLEGLDYSVDVEENLTARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEKDFIAFCSSTPHNVSWRDSTMGSIFITQLITCFQKYSWCCHLEEVFRKVQQSFETPRAKAQMPTIERLSMTRYFYLFPGN nlrp1_human NACHT, LRR and PYD domains-containing protein 1 NLRP1 CARD7 DEFCAP KIAA0926 NAC NALP1 Death effector filament-forming ced-4-like apoptosis protein Nucleotide-binding domain and caspase recruitment domain Caspase recruitment domain-containing protein 7 protein protein human Homo sapiens Human MAGGAWGRLACYLEFLKKEELKEFQLLLANKAHSRSSSGETPAQPEKTSGMEVASYLVAQYGEQRAWDLALHTWEQMGLRSLCAQAQEGAGHSPSFPYSPSEPHLGSPSQPTSTAVLMPWIHELPAGCTQGSERRVLRQLPDTSGRRWREISASLLYQALPSSPDHESPSQESPNAPTSTAVLGSWGSPPQPSLAPREQEAPGTQWPLDETSGIYYTEIREREREKSEKGRPPWAAVVGTPPQAHTSLQPHHHPWEPSVRESLCSTWPWKNEDFNQKFTQLLLLQRPHPRSQDPLVKRSWPDYVEENRGHLIEIRDLFGPGLDTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCRELAQSKVVSLAELIGKDGTATPAPIRQILSRPERLLFILDGVDEPGWVLQEPSSELCLHWSQPQPADALLGSLLGKTILPEASFLITARTTALQNLIPSLEQARWVEVLGFSESSRKEYFYRYFTDERQAIRAFRLVKSNKELWALCLVPWVSWLACTCLMQQMKRKEKLTLTSKTTTTLCLHYLAQALQAQPLGPQLRDLCSLAAEGIWQKKTLFSPDDLRKHGLDGAIISTFLKMGILQEHPIPLSYSFIHLCFQEFFAAMSYVLEDEKGRGKHSNCIIDLEKTLEAYGIHGLFGASTTRFLLGLLSDEGEREMENIFHCRLSQGRNLMQWVPSLQLLLQPHSLESLHCLYETRNKTFLTQVMAHFEEMGMCVETDMELLVCTFCIKFSRHVKKLQLIEGRQHRSTWSPTMVVLFRWVPVTDAYWQILFSVLKVTRNLKELDLSGNSLSHSAVKSLCKTLRRPRCLLETLRLAGCGLTAEDCKDLAFGLRANQTLTELDLSFNVLTDAGAKHLCQRLRQPSCKLQRLQLVSCGLTSDCCQDLASVLSASPSLKELDLQQNNLDDVGVRLLCEGLRHPACKLIRLGLDQTTLSDEMRQELRALEQEKPQLLIFSRRKPSVMTPTEGLDTGEMSNSTSSLKRQRLGSERAASHVAQANLKLLDVSKIFPIAEIAEESSPEVVPVELLCVPSPASQGDLHTKPLGTDDDFWGPTGPVATEVVDKEKNLYRVHFPVAGSYRWPNTGLCFVMREAVTVEIEFCVWDQFLGEINPQHSWMVAGPLLDIKAEPGAVEAVHLPHFVALQGGHVDTSLFQMAHFKEEGMLLEKPARVELHHIVLENPSFSPLGVLLKMIHNALRFIPVTSVVLLYHRVHPEEVTFHLYLIPSDCSIRKAIDDLEMKFQFVRIHKPPPLTPLYMGCRYTVSGSGSGMLEILPKELELCYRSPGEDQLFSEFYVGHLGSGIRLQVKDKKDETLVWEALVKPGDLMPATTLIPPARIAVPSPLDAPQLLHFVDQYREQLIARVTSVEVVLDKLHGQVLSQEQYERVLAENTRPSQMRKLFSLSQSWDRKCKDGLYQALKETHPHLIMELWEKGSKKGLLPLSS casp1-nod2-1 3172242 N/A 3172250 unspecified role unspecified role bait bait flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3172251 unspecified role unspecified role prey prey Ha tag Ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false casp1-nod2-2 3172243 N/A 3172252 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3172253 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false casp4-nod2-1 3172244 N/A 3172252 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3172254 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false casp1-nlrp1-1 3172245 N/A 3172252 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3172253 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3172255 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association false false false casp1-nlrp1-2 3172246 N/A 3172255 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3172253 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false casp1-nod2-3 3172247 N/A 3172252 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3172253 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false casp1-nod2-4 3172248 N/A 3172252 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3172253 unspecified role unspecified role bait bait Myc tag Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 8-89 binding site 8-89 binding site sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false nod2-nlrp1-1 3172249 N/A 3172252 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3172255 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false