DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ klein-2008-1 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Klein DE., Stayrook SE., Shi F., Narayan K., Lemmon MA. DIP original experiment: DIP-259426X Nature 2008 IMEx Structural basis for EGFR ligand sequestration by Argos. Klein DE., Stayrook SE., Shi F., Narayan K., Lemmon MA. Only protein-protein interactions imex curation klein-2008-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Klein DE., Stayrook SE., Shi F., Narayan K., Lemmon MA. DIP original experiment: DIP-259429X Nature 2008 IMEx Structural basis for EGFR ligand sequestration by Argos. Klein DE., Stayrook SE., Shi F., Narayan K., Lemmon MA. Only protein-protein interactions imex curation klein-2008-3 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Klein DE., Stayrook SE., Shi F., Narayan K., Lemmon MA. DIP original experiment: DIP-259427X Nature 2008 IMEx Structural basis for EGFR ligand sequestration by Argos. Klein DE., Stayrook SE., Shi F., Narayan K., Lemmon MA. Only protein-protein interactions imex curation klein-2008-4 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Klein DE., Stayrook SE., Shi F., Narayan K., Lemmon MA. DIP original experiment: DIP-259430X Nature 2008 IMEx Structural basis for EGFR ligand sequestration by Argos. Klein DE., Stayrook SE., Shi F., Narayan K., Lemmon MA. Only protein-protein interactions imex curation klein-2008-5 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Klein DE., Stayrook SE., Shi F., Narayan K., Lemmon MA. DIP original experiment: DIP-259428X Nature 2008 IMEx Structural basis for EGFR ligand sequestration by Argos. Klein DE., Stayrook SE., Shi F., Narayan K., Lemmon MA. Only protein-protein interactions imex curation gil_drome Protein giant-lens Protein argos Protein strawberry aos gil sty CG4531 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPTTLMLLPCMLLLLLTAAAVAVGGTRLPLEVFEITPTTSTADKHKSLQYTVVYDAKDISGAAAATGVASSTVKPATEQLTVVSISSTAAAEKDLAESRRHARQMLQKQQQHRSIIGGKHGDRDVRILYQVGDSEEDLPVCAPNAVCSKIDLYETPWIERQCRCPESNRMPNNVIIHHHSHSSGSVDSLKYRNYYEREKMMQHKRMLLGEFQDKKFESLHMKKLMQKLGAVYEDDLDHLDQSPDYNDALPYAEVQDNEFPRGSAHMRHSGHRGSKEPATTFIGGCPSSLGVEDGHTIADKTRHYKMCQPVHKLPVCTHFRDYTWTLTTAAELNVTEQIVHCRCPRNSVTYLTKREPIGNGSPGYRYLFACSPLTRLRCQRKQPCKLFTVRKRQEFLDEVNINSLCQCPKGHRCPSHHTQSGVIAGESFLEDNIQTYSGYCMAND spitz_drome Protein spitz spi CG10334 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MHSTMSVQHGLVALVLIGCLAHPWHVEACSSRTVPKPRSSISSSMSGTALPPTQAPVTSSTTMRTTTTTTPRPNITFPTYKCPETFDAWYCLNDAHCFAVKIADLPVYSCECAIGFMGQRCEYKEIDNTYLPKRPRPMLEKASIASGAMCALVFMLFVCLAFYLRFEQRAAKKAYELEQELQQEYDDDDGQCECCRNRCCPDGQEPVILERKLPYHMRLEHALMSFAIRRSNKL aos-1 3171927 N/A 3171932 unspecified role unspecified role unspecified role unspecified role Region 113-164/285-444 Region 113-164/285-444 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false aos-spi-1 3171928 N/A 3171933 unspecified role unspecified role unspecified role unspecified role Region 76-127 Region 76-127 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3171932 unspecified role unspecified role unspecified role unspecified role Region 113-164/285-444 Region 113-164/285-444 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false aos-2 3171929 N/A 3171932 unspecified role unspecified role unspecified role unspecified role Region 113-164/285-444 Region 113-164/285-444 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false spi-aos-1 3171930 N/A 3171933 unspecified role unspecified role bait bait Region 76-127 Region 76-127 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3171932 unspecified role unspecified role prey prey Region 113-164/285-444 Region 113-164/285-444 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false aos-3 3171931 N/A 3171932 unspecified role unspecified role unspecified role unspecified role Region 113-164/285-444 Region 113-164/285-444 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false