DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ smits-2008-1 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Smits C., Czabotar PE., Hinds MG., Day CL. DIP original experiment: DIP-68468X Structure (London, England : 1993) 2008 IMEx Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Smits C., Czabotar PE., Hinds MG., Day CL. Only protein-protein interactions imex curation smits-2008-2 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Smits C., Czabotar PE., Hinds MG., Day CL. DIP original experiment: DIP-68466X Structure (London, England : 1993) 2008 IMEx Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Smits C., Czabotar PE., Hinds MG., Day CL. Only protein-protein interactions imex curation smits-2008-3 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Smits C., Czabotar PE., Hinds MG., Day CL. DIP original experiment: DIP-68472X Structure (London, England : 1993) 2008 IMEx Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Smits C., Czabotar PE., Hinds MG., Day CL. Only protein-protein interactions imex curation smits-2008-4 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Smits C., Czabotar PE., Hinds MG., Day CL. DIP original experiment: DIP-68470X Structure (London, England : 1993) 2008 IMEx Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Smits C., Czabotar PE., Hinds MG., Day CL. Only protein-protein interactions imex curation smits-2008-5 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Smits C., Czabotar PE., Hinds MG., Day CL. DIP original experiment: DIP-68469X Structure (London, England : 1993) 2008 IMEx Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Smits C., Czabotar PE., Hinds MG., Day CL. Only protein-protein interactions imex curation smits-2008-6 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Smits C., Czabotar PE., Hinds MG., Day CL. DIP original experiment: DIP-68467X Structure (London, England : 1993) 2008 IMEx Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Smits C., Czabotar PE., Hinds MG., Day CL. Only protein-protein interactions imex curation smits-2008-7 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Smits C., Czabotar PE., Hinds MG., Day CL. DIP original experiment: DIP-68473X Structure (London, England : 1993) 2008 IMEx Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Smits C., Czabotar PE., Hinds MG., Day CL. Only protein-protein interactions imex curation smits-2008-8 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Smits C., Czabotar PE., Hinds MG., Day CL. DIP original experiment: DIP-68471X Structure (London, England : 1993) 2008 IMEx Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Smits C., Czabotar PE., Hinds MG., Day CL. Only protein-protein interactions imex curation bmf_mouse Bcl-2-modifying factor Bmf protein protein mouse Mus musculus Mouse MEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQQNRDRAWWQVFLFLQNLALNRQENREGVGPW b2la1_mouse Bcl-2-related protein A1 Protein BFL-1 Hemopoietic-specific early response protein A1-A Bcl2a1 A1 Bcl2a1a Bfl1 protein protein mouse Mus musculus Mouse MAESELMHIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVCAYKQVSSFVAEFIMNNTGEWIRQNGGWEDGFIKKFEPKSGWLTFLQMTGQIWEMLFLLK bbc3_mouse Bcl-2-binding component 3 Bbc3 Puma p53 up-regulated modulator of apoptosis protein protein mouse Mus musculus Mouse MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGHRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRVEEEEWAREIGAQLRRMADDLNAQYERRRQEEQHRHRPSPWRVMYNLFMGLLPLPRDPGAPEMEPN bid_mouse BH3-interacting domain death agonist p22 BID Bid protein protein mouse Mus musculus Mouse MDSEVSNGSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD bak_mouse Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bak1 Bak protein protein mouse Mus musculus Mouse MASGQGPGPPKVGCDESPSPSEQQVAQDTEEVFRSYVFYLHQQEQETQGAAAPANPEMDNLPLEPNSILGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSGISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHYIARWIAQRGGWVAALNFRRDPILTVMVIFGVVLLGQFVVHRFFRS bcl2a1-bmf-1 3171305 N/A 3171313 unspecified role unspecified role unspecified role unspecified role Region 126-152 Region 126-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3171314 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bbc3-bcl2a1-2 3171306 N/A 3171315 unspecified role unspecified role unspecified role unspecified role Region 130-155 Region 130-155 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3171314 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bcl2a1-bid-1 3171307 N/A 3171316 unspecified role unspecified role unspecified role unspecified role Region 76-109 Region 76-109 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3171314 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bak1-bcl2a1-1 3171308 N/A 3171317 unspecified role unspecified role unspecified role unspecified role Region 64-89 Region 64-89 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3171314 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bcl2a1-bmf-2 3171309 N/A 3171313 unspecified role unspecified role unspecified role unspecified role Region 126-152 Region 126-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3171314 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bbc3-bcl2a1-3 3171310 N/A 3171315 unspecified role unspecified role unspecified role unspecified role Region 130-155 Region 130-155 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3171314 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bcl2a1-bid-2 3171311 N/A 3171316 unspecified role unspecified role unspecified role unspecified role Region 76-109 Region 76-109 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3171314 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bak1-bcl2a1-2 3171312 N/A 3171317 unspecified role unspecified role unspecified role unspecified role Region 64-89 Region 64-89 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3171314 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false