DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ rushe-2008-1 in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. DIP original experiment: DIP-68459X Structure (London, England : 1993) 2008 IMEx Structure of a NEMO/IKK-associating domain reveals architecture of the interaction site. Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. Only protein-protein interactions imex curation rushe-2008-2 in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. DIP original experiment: DIP-68449X Structure (London, England : 1993) 2008 IMEx Structure of a NEMO/IKK-associating domain reveals architecture of the interaction site. Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. Only protein-protein interactions imex curation rushe-2008-3 in vitro In vitro sls static light scattering sls predetermined predetermined participant predetermined Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. DIP original experiment: DIP-68454X Structure (London, England : 1993) 2008 IMEx Structure of a NEMO/IKK-associating domain reveals architecture of the interaction site. Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. Only protein-protein interactions imex curation rushe-2008-4 ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. DIP original experiment: DIP-68452X Structure (London, England : 1993) 2008 IMEx Structure of a NEMO/IKK-associating domain reveals architecture of the interaction site. Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. Only protein-protein interactions imex curation rushe-2008-5 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. DIP original experiment: DIP-68455X Structure (London, England : 1993) 2008 IMEx Structure of a NEMO/IKK-associating domain reveals architecture of the interaction site. Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. Only protein-protein interactions imex curation rushe-2008-6 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. DIP original experiment: DIP-68457X Structure (London, England : 1993) 2008 IMEx Structure of a NEMO/IKK-associating domain reveals architecture of the interaction site. Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. Only protein-protein interactions imex curation rushe-2008-7 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. DIP original experiment: DIP-68453X Structure (London, England : 1993) 2008 IMEx Structure of a NEMO/IKK-associating domain reveals architecture of the interaction site. Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. Only protein-protein interactions imex curation rushe-2008-8 in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. DIP original experiment: DIP-68460X Structure (London, England : 1993) 2008 IMEx Structure of a NEMO/IKK-associating domain reveals architecture of the interaction site. Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. Only protein-protein interactions imex curation rushe-2008-9 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. DIP original experiment: DIP-68450X Structure (London, England : 1993) 2008 IMEx Structure of a NEMO/IKK-associating domain reveals architecture of the interaction site. Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. Only protein-protein interactions imex curation rushe-2008-10 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. DIP original experiment: DIP-68456X Structure (London, England : 1993) 2008 IMEx Structure of a NEMO/IKK-associating domain reveals architecture of the interaction site. Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. Only protein-protein interactions imex curation rushe-2008-11 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. DIP original experiment: DIP-68458X Structure (London, England : 1993) 2008 IMEx Structure of a NEMO/IKK-associating domain reveals architecture of the interaction site. Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. Only protein-protein interactions imex curation rushe-2008-12 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. DIP original experiment: DIP-68451X Structure (London, England : 1993) 2008 IMEx Structure of a NEMO/IKK-associating domain reveals architecture of the interaction site. Rushe M., Silvian L., Bixler S., Chen LL., Cheung A., Bowes S., Cuervo H., Berkowitz S., Zheng T., Guckian K., Pellegrini M., Lugovskoy A. Only protein-protein interactions imex curation ikkalpha IKK-alpha peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) MMNLDWSWLTE nemo_human NF-kappa-B essential modulator IKBKG FIP3 NEMO NF-kappa-B essential modifier Inhibitor of nuclear factor kappa-B kinase subunit gamma IkB kinase-associated protein 1 FIP-3 protein protein human Homo sapiens Human MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE ikkalpha/beta IKKalpha/beta hybrid peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) PAKKSEELVAEAHNLCTLLENAIQDTVREQGNSMMNLDWSWLTE ikkb_human Inhibitor of nuclear factor kappa-B kinase subunit beta IKBKB IKKB I-kappa-B kinase 2 Nuclear factor NF-kappa-B inhibitor kinase beta Serine/threonine protein kinase IKBKB protein protein human Homo sapiens Human MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLMLMWHPRQRGTDPTYGPNGCFKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRNLAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLKAKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKLLVERMMALQTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQSFEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKIACSKVRGPVSGSPDSMNASRLSQPGQLMSQPSTASNSLPEPAKKSEELVAEAHNLCTLLENAIQDTVREQDQSFTALDWSWLQTEEEEHSCLEQAS ikkbeta IKK-beta peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) FTALDWSWLQT ikbkg-ikkalpha-1 3171215 N/A 3171227 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Biotin-tag Biotin-tag biotin tag biotin tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal false in vitro In vitro N/A 3171228 unspecified role unspecified role fluorescence donor fluorescence donor Region 1-196 Region 1-196 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false ikbkg-ikkalpha/beta-1 3171216 N/A 3171229 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Biotin-tag Biotin-tag biotin tag biotin tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal false in vitro In vitro N/A 3171228 unspecified role unspecified role fluorescence donor fluorescence donor Region 44-111 Region 44-111 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false ikbkg-ikkalpha/beta-2 3171217 N/A 3171229 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3171228 unspecified role unspecified role unspecified role unspecified role Region 44-111 Region 44-111 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ikbkg-1 3171218 N/A 3171228 unspecified role unspecified role unspecified role unspecified role Region 1-196 Region 1-196 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ikbkg-ikkalpha/beta-3 3171219 N/A 3171229 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3171228 unspecified role unspecified role unspecified role unspecified role Region 44-111 Region 44-111 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ikbkb-ikbkg-11 3171220 N/A 3171230 unspecified role unspecified role unspecified role unspecified role Region 701-746 Region 701-746 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3171228 unspecified role unspecified role unspecified role unspecified role Region 44-111 Region 44-111 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ikbkg-ikkalpha/beta-4 3171221 N/A 3171229 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3171228 unspecified role unspecified role unspecified role unspecified role Region 44-111 Region 44-111 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ikbkg-ikkbeta-1 3171222 N/A 3171231 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Biotin-tag Biotin-tag biotin tag biotin tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal false in vitro In vitro N/A 3171228 unspecified role unspecified role fluorescence donor fluorescence donor Region 1-196 Region 1-196 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false ikbkg-2 3171223 N/A 3171228 unspecified role unspecified role unspecified role unspecified role Region 1-196 Region 1-196 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ikbkg-ikkalpha/beta-5 3171224 N/A 3171229 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3171228 unspecified role unspecified role unspecified role unspecified role Region 44-111 Region 44-111 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ikbkg-ikkalpha/beta-6 3171225 N/A 3171229 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3171228 unspecified role unspecified role unspecified role unspecified role Region 44-111 Region 44-111 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ikbkg-3 3171226 N/A 3171228 unspecified role unspecified role unspecified role unspecified role Region 1-196 Region 1-196 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false