DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ banci-2008-1 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Banci L., Bertini I., Ciofi-Baffoni S., Hadjiloi T., Martinelli M., Palumaa P. DIP original experiment: DIP-110981X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mitochondrial copper(I) transfer from Cox17 to Sco1 is coupled to electron transfer. Banci L., Bertini I., Ciofi-Baffoni S., Hadjiloi T., Martinelli M., Palumaa P. Only protein-protein interactions imex curation banci-2008-2 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Banci L., Bertini I., Ciofi-Baffoni S., Hadjiloi T., Martinelli M., Palumaa P. DIP original experiment: DIP-110982X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mitochondrial copper(I) transfer from Cox17 to Sco1 is coupled to electron transfer. Banci L., Bertini I., Ciofi-Baffoni S., Hadjiloi T., Martinelli M., Palumaa P. Only protein-protein interactions imex curation banci-2008-3 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Banci L., Bertini I., Ciofi-Baffoni S., Hadjiloi T., Martinelli M., Palumaa P. DIP original experiment: DIP-110983X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mitochondrial copper(I) transfer from Cox17 to Sco1 is coupled to electron transfer. Banci L., Bertini I., Ciofi-Baffoni S., Hadjiloi T., Martinelli M., Palumaa P. Only protein-protein interactions imex curation cox17_human Cytochrome c oxidase copper chaperone COX17 protein protein human Homo sapiens Human MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI sco1_human Protein SCO1 homolog, mitochondrial SCO1 SCOD1 protein protein human Homo sapiens Human MAMLVLVPGRVMRPLGGQLWRFLPRGLEFWGPAEGTARVLLRQFCARQAEAWRASGRPGYCLGTRPLSTARPPPPWSQKGPGDSTRPSKPGPVSWKSLAITFAIGGALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKKS sco2_human Protein SCO2 homolog, mitochondrial SCO2 protein protein human Homo sapiens Human MLLLTRSPTAWHRLSQLKPRVLPGTLGGQALHLRSWLLSRQGPAETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS cox17-sco1-1 3171043 N/A 3171046 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3171047 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false cox17-sco2-1 3171044 N/A 3171048 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3171046 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false cox17-sco1-2 3171045 N/A 3171046 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3171047 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false