DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ engel-2008-1 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Engel MF., Khemtémourian L., Kleijer CC., Meeldijk HJ., Jacobs J., Verkleij AJ., de Kruijff B., Killian JA., Höppener JW. DIP original experiment: DIP-68655X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Membrane damage by human islet amyloid polypeptide through fibril growth at the membrane. Engel MF., Khemtémourian L., Kleijer CC., Meeldijk HJ., Jacobs J., Verkleij AJ., de Kruijff B., Killian JA., Höppener JW. Only protein-protein interactions imex curation engel-2008-2 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Engel MF., Khemtémourian L., Kleijer CC., Meeldijk HJ., Jacobs J., Verkleij AJ., de Kruijff B., Killian JA., Höppener JW. DIP original experiment: DIP-68656X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Membrane damage by human islet amyloid polypeptide through fibril growth at the membrane. Engel MF., Khemtémourian L., Kleijer CC., Meeldijk HJ., Jacobs J., Verkleij AJ., de Kruijff B., Killian JA., Höppener JW. Only protein-protein interactions imex curation engel-2008-3 in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Engel MF., Khemtémourian L., Kleijer CC., Meeldijk HJ., Jacobs J., Verkleij AJ., de Kruijff B., Killian JA., Höppener JW. DIP original experiment: DIP-68657X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Membrane damage by human islet amyloid polypeptide through fibril growth at the membrane. Engel MF., Khemtémourian L., Kleijer CC., Meeldijk HJ., Jacobs J., Verkleij AJ., de Kruijff B., Killian JA., Höppener JW. Only protein-protein interactions imex curation iapp_human Islet amyloid polypeptide IAPP Amylin Diabetes-associated peptide Insulinoma amyloid peptide protein protein human Homo sapiens Human MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL not sure about the protein origin mint iapp-6 3170559 N/A 3170562 unspecified role unspecified role unspecified role unspecified role in vitro In vitro direct interaction direct interaction false false false iapp-7 3170560 N/A 3170562 unspecified role unspecified role unspecified role unspecified role in vitro In vitro direct interaction direct interaction false false false iapp-8 3170561 N/A 3170562 unspecified role unspecified role unspecified role unspecified role in vitro In vitro direct interaction direct interaction false false false