DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhou-2008-8 mouse Mus musculus Mouse pull down pull down predetermined predetermined participant predetermined Zhou X., Ferraris JD., Dmitrieva NI., Liu Y., Burg MB. DIP original experiment: DIP-68596X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx MKP-1 inhibits high NaCl-induced activation of p38 but does not inhibit the activation of TonEBP/OREBP: opposite roles of p38alpha and p38delta. Zhou X., Ferraris JD., Dmitrieva NI., Liu Y., Burg MB. Only protein-protein interactions imex curation mk14_rat Mitogen-activated protein kinase 14 Mapk14 Csbp1 Csbp2 Mitogen-activated protein kinase p38 alpha CRK1 protein protein rat Rattus norvegicus (Rat) Rat MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVAEPYDQSFESRDFLIDEWKSLTYDEVISFVPPPLDQEEMES mint Responds to activation by environmental stress, pro-inflammatory cytokines and lipopolysaccharide (LPS) by phosphorylating a number of transcription factors, such as ELK1 and ATF2 and several downstream kinases, such as MAPKAPK2 and MAPKAPK5. Plays a critical role in the production of some cytokines, for example IL-6. May play a role in stabilization of EPO during hypoxic stress dus1_mouse Dual specificity protein phosphatase 1 Dusp1 3ch134 Mkp1 Ptpn10 Ptpn16 Mitogen-activated protein kinase phosphatase 1 Protein-tyrosine phosphatase 3CH134 Protein-tyrosine phosphatase ERP protein protein mouse Mus musculus Mouse MVMEVGILDAGGLRALLREGAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAMGLEHIVPNAELRGRLLAGAYHAVVLLDERSASLDGAKRDGTLALAAGALCREARSTQVFFLQGGYEAFSASCPELCSKQSTPTGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILSFLYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEAIDFIDSIKDAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHPTNSALNYLKSPITTSPSC mapk14-dusp1-1 3169948 N/A 3169949 unspecified role unspecified role bait bait GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse N/A 3169950 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false