DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kan-2008-1 rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kan Q., Jinno S., Yamamoto H., Kobayashi K., Okayama H. DIP original experiment: DIP-68574X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx ATP-dependent activation of p21WAF1/CIP1-associated Cdk2 by Cdc6. Kan Q., Jinno S., Yamamoto H., Kobayashi K., Okayama H. Only protein-protein interactions imex curation kan-2008-2 rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kan Q., Jinno S., Yamamoto H., Kobayashi K., Okayama H. DIP original experiment: DIP-68572X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx ATP-dependent activation of p21WAF1/CIP1-associated Cdk2 by Cdc6. Kan Q., Jinno S., Yamamoto H., Kobayashi K., Okayama H. Only protein-protein interactions imex curation kan-2008-3 rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kan Q., Jinno S., Yamamoto H., Kobayashi K., Okayama H. DIP original experiment: DIP-68575X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx ATP-dependent activation of p21WAF1/CIP1-associated Cdk2 by Cdc6. Kan Q., Jinno S., Yamamoto H., Kobayashi K., Okayama H. Only protein-protein interactions imex curation kan-2008-4 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kan Q., Jinno S., Yamamoto H., Kobayashi K., Okayama H. DIP original experiment: DIP-68573X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx ATP-dependent activation of p21WAF1/CIP1-associated Cdk2 by Cdc6. Kan Q., Jinno S., Yamamoto H., Kobayashi K., Okayama H. Only protein-protein interactions imex curation kan-2008-5 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kan Q., Jinno S., Yamamoto H., Kobayashi K., Okayama H. DIP original experiment: DIP-68576X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx ATP-dependent activation of p21WAF1/CIP1-associated Cdk2 by Cdc6. Kan Q., Jinno S., Yamamoto H., Kobayashi K., Okayama H. Only protein-protein interactions imex curation skp1_rat S-phase kinase-associated protein 1 Skp1 Skp1a S-phase kinase-associated protein 1A Cyclin-A/CDK2-associated protein p19 p19skp1 p19A protein protein rat Rattus norvegicus (Rat) Rat MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK g3v802_rat Cyclin-A2 Ccna2 rCG_41610 protein protein rat Rattus norvegicus (Rat) Rat MPGNSRQAGSALLSQQEDQENVNPEKVAPAQQPRAQAVLKAGKVRGPAPQQRLKTRRVAPLKDLPINDEHVPTVPSWKAVSKQPAFTIHVDEAEETQKRPAEQKETQCEDALAFSAAVSLPGARKPLVPLDYPMDGSFESPHAMDISIVLEDEKPVNVNEVPDYHEDIHTYLREMEVKCKPKVSYMKRQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPTVNQFLTQYFLHLQPANCKVESLAMFLGELSLIDADPYLKYLPSLIAGAAFHLALYTVTGQSWPESLVQKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPETLNV 1E6DC38B643D0F19 q64315_rat Cdkn1a cip1 WAF1 rCG_61102 protein protein rat Rattus norvegicus (Rat) Rat MSDPGDVRPVPHRSKVCRRLFGPVDSEQLSRDCDALMASCLQEARERWNFDFATETPLEGNYVWERVRSPGLPKIYLSPGSRRRDDLGGDKRPSTSSALLQGPGPAPEDHVALSLSCTLVSHAPERPEDSPGGTGTSQGRKRRQTSLTDFYHSKRRLVFCKRKP ccne1_rat G1/S-specific cyclin-E1 Ccne1 Ccne protein protein rat Rattus norvegicus (Rat) Rat MPRERKERDSKDHTKMKEEGGSDLSVRSRKRKPNVPVFLQDPDEEIAKIDKTVKSQDSSQPWDDDSACVDPCSFIPTPNKEEDNELEYPKTAFQPRKIRPPRASPLPVLNWANREEVWRIMLNKEKTYLRDEHFLQRHPLLQARMRAVLLDWLMEVCEVYKLHRETFYLAQDFFDRYMASQQNIIKTLLQLIGISALFIASKLEEIYPPKLHQFAYVTDGACSGDEILTMELMMMKALKWRLSPLTIVSWLNVYVQVAYVNDTGEVLMPQYPQQVFVQIAELLDLCVLDVGCLEFPYGVLAASALYHFSSLELMQKVSGYQWCDIEKCVKWMVPFAMVIREMGSSKLKHFRGVPMEDSHNIQTHTNSLDLLDKAQAKKAILSEQNRISPPPSGVLTPPHSSKKQSSEQETE d3zrk7_rat Cell division control protein Cdc6 Cdc6_predicted rCG_34910 protein protein rat Rattus norvegicus (Rat) Rat MPQTRSQTQATIDFPKKKQSKTLSKTNSRDSEVKLRNVQPVPTTPCADIKILPLSPRKRLGDDNLCNTPHLSPCSPPKLGRKENGPPRSHTRKGCRLIFDDELAVKASAPKEQDRVPQHQILSSAQRGQESETNPEQKCPPEKESACMRLFKQEGTCYQQAKLVLNTAVPDRLPAREQEMGVIRDFLKEHICGKKAGSLYLSGAPGTGKTACLSRILQDFKKEVKGFKTIVLNCMSLRNAQAVFPAIAQEIGREELCRPTGKDLMRKLEKHLTAERGPMIVLVLDEMDQLDSKGQDVLYTLFEWPWLSNSRLVLIGIANTLDLTDRILPRLEAREGCKPKLLNFPPYTRNQIAAILQDRLSQVSKDQVLDSAAIQFCARKVSAVSGDIRKALDVCRRAIEIVESDVRSQTVLKPLSECKSPCESLVPKRVGLAHISQVISGVDGNRVTLSQENTQDSLPLQQKILVCSLLLLTKRLKIKEVTLGKLYEAYSSVCRKQQVAAVDQSECLSLSGLLESRGIVGLKKNKESRLTKVSLKIEEKEIEHVLKGKAFIGNILAAGLP DB442EA93D249296 cyca-skp1-1 3169831 N/A 3169836 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat N/A 3169837 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat physical association physical association false false false skp1-ccne1-1 3169832 N/A 3169838 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat N/A 3169837 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat N/A 3169839 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat N/A 3169836 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat association association false false false ccne1-skp1-1 3169833 N/A 3169836 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat N/A 3169839 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat physical association physical association false false false skp1-cdc6-1 3169834 N/A 3169836 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat N/A 3169840 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat physical association physical association false false false skp1-cdc6-2 3169835 N/A 3169836 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat N/A 3169840 unspecified role unspecified role prey prey his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false rat Rattus norvegicus (Rat) Rat physical association physical association false false false