DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ miyawaki-2008-1 rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Miyawaki T., Mashiko T., Ofengeim D., Flannery RJ., Noh KM., Fujisawa S., Bonanni L., Bennett MV., Zukin RS., Jonas EA. DIP original experiment: DIP-68571X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Ischemic preconditioning blocks BAD translocation, Bcl-xL cleavage, and large channel activity in mitochondria of postischemic hippocampal neurons. Miyawaki T., Mashiko T., Ofengeim D., Flannery RJ., Noh KM., Fujisawa S., Bonanni L., Bennett MV., Zukin RS., Jonas EA. Only protein-protein interactions imex curation p53563-1 Bcl-2-like protein 1 Bcl-xL Bcl2l1 Bclx Blc2l Apoptosis regulator Bcl-X protein protein rat Rattus norvegicus (Rat) Rat MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK bad_rat Bcl2-associated agonist of cell death Bcl2 antagonist of cell death Bcl-2-binding component 6 Bcl-xL/Bcl-2-associated death promoter Bad protein protein rat Rattus norvegicus (Rat) Rat MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASTTDRGLGPSLTEDQPGPYLAPGLLGSIVQQQPGQAANNSHHGGAGTMETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQSASWTRIIQSWWDRNLGKGGSTPSQ bcl2l1-bad-7 3169697 N/A 3169698 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat N/A 3169699 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat physical association physical association false false false