DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ pfeifer-2008-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pfeifer I., Elsby R., Fernandez M., Faria PA., Nussenzveig DR., Lossos IS., Fontoura BM., Martin WD., Barber GN. DIP original experiment: DIP-68547X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx NFAR-1 and -2 modulate translation and are required for efficient host defense. Pfeifer I., Elsby R., Fernandez M., Faria PA., Nussenzveig DR., Lossos IS., Fontoura BM., Martin WD., Barber GN. Only protein-protein interactions imex curation pfeifer-2008-2 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pfeifer I., Elsby R., Fernandez M., Faria PA., Nussenzveig DR., Lossos IS., Fontoura BM., Martin WD., Barber GN. DIP original experiment: DIP-68545X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx NFAR-1 and -2 modulate translation and are required for efficient host defense. Pfeifer I., Elsby R., Fernandez M., Faria PA., Nussenzveig DR., Lossos IS., Fontoura BM., Martin WD., Barber GN. Only protein-protein interactions imex curation pfeifer-2008-3 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pfeifer I., Elsby R., Fernandez M., Faria PA., Nussenzveig DR., Lossos IS., Fontoura BM., Martin WD., Barber GN. DIP original experiment: DIP-68548X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx NFAR-1 and -2 modulate translation and are required for efficient host defense. Pfeifer I., Elsby R., Fernandez M., Faria PA., Nussenzveig DR., Lossos IS., Fontoura BM., Martin WD., Barber GN. Only protein-protein interactions imex curation pfeifer-2008-4 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pfeifer I., Elsby R., Fernandez M., Faria PA., Nussenzveig DR., Lossos IS., Fontoura BM., Martin WD., Barber GN. DIP original experiment: DIP-68546X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx NFAR-1 and -2 modulate translation and are required for efficient host defense. Pfeifer I., Elsby R., Fernandez M., Faria PA., Nussenzveig DR., Lossos IS., Fontoura BM., Martin WD., Barber GN. Only protein-protein interactions imex curation ilf3_human Interleukin enhancer-binding factor 3 ILF3 MPHOSPH4 NF90 Nuclear factor of activated T-cells 90 kDa Double-stranded RNA-binding protein 76 Translational control protein 80 Nuclear factor associated with dsRNA M-phase phosphoprotein 4 DRBF protein protein human Homo sapiens Human MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLRGVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAAVTEDKYEILQSVDDAAIVIKNTKEPPLSLTIHLTSPVVREEMEKVLAGETLSVNDPPDVLDRQKCLAALASLRHAKWFQARANGLKSCVIVIRVLRDLCTRVPTWGPLRGWPLELLCEKSIGTANRPMGAGEALRRVLECLASGIVMPDGSGIYDPCEKEATDAIGHLDRQQREDITQSAQHALRLAAFGQLHKVLGMDPLPSKMPKKPKNENPVDYTVQIPPSTTYAITPMKRPMEEDGEEKSPSKKKKKIQKKEEKAEPPQAMNALMRLNQLKPGLQYKLVSQTGPVHAPIFTMSVEVDGNSFEASGPSKKTAKLHVAVKVLQDMGLPTGAEGRDSSKGEDSAEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAEQGPILTKHGKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPLALDANKKKRAPVPVRGGPKFAAKPHNPGFGMGGPMHNEVPPPPNLRGRGRGGSIRGRGRGRGFGGANHGGYMNAGAGYGSYGYGGNSATAGYSQFYSNGGHSGNASGGGGGGGGGSSGYGSYYQGDNYNSPVPPKHAGKKQPHGGQQKPSYGSGYQSHQGQQQSYNQSPYSNYGPPQGKQKGYNHGQGSYSYSNSYNSPGGGGGSDYNYESKFNYSGSGGRSGGNSYGSGGASYNPGSHGGYGGGSGGGSSYQGKQGGYSQSNYNSPGSGQNYSGPPSSYQSSQGGYGRNADHSMNYQYR matrx_vsnjo Matrix protein M protein protein vsnjo vsnjo VSNJV MSSFKKILGLSSKSHKKSKKMGLPPPYDESCPMETQPSAPLSNDFFGMEDMDLYDKDSLRYEKFRFMLKMTVRSNKPFRSYDDVTAAVSQWDNSYIGMVGKRPFYKIIAVIGSSHLQATPAVLADLNQPEYYATLTGRCFLPHRLGLIPPMFNVQETFRKPFNIGLYKGTLDFTFTVSDDESNEKVPHVWDYMNPKYQSQIQQEGLKFGLILSKKATGTWVLDQLSPFK a6h4p0_9rhab G protein protein vesicular stomatitis virus Vesicular stomatitis virus EMADKALFAAARFPECPEGSSISAPSQTSVDVSLIQDIERILDYSLCQETWSKIRAGLPISPVDLSYLAPKNPGTGPVFTIINGTLKYFETRYIRVDIAAPILSRMVGMISGTTTERVLWDDWAPYEDVEIGPNGVLRTSSGYKFPLYMIGHGMLDSDLHLSSKAQVFEHP hnrpc_human Heterogeneous nuclear ribonucleoproteins C1/C2 HNRNPC HNRPC protein protein human Homo sapiens Human MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS ilf3-m-1 3169571 N/A 3169575 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3169576 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false hnrnpc-g-1 3169572 N/A 3169577 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3169576 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3169578 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false ilf3-g-1 3169573 N/A 3169577 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3169575 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3169576 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false hnrnpc-ilf3-1 3169574 N/A 3169575 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3169576 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3169578 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false