DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ watanabe-2008-4 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Watanabe S., Kita A., Kobayashi K., Miki K. DIP original experiment: DIP-68535X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Crystal structure of the [2Fe-2S] oxidative-stress sensor SoxR bound to DNA. Watanabe S., Kita A., Kobayashi K., Miki K. Only protein-protein interactions imex curation soxr_ecoli Redox-sensitive transcriptional activator SoxR soxR marC b4063 JW4024 protein protein ecoli Escherichia coli (strain K12) MEKKLPRIKALLTPGEVAKRSGVAVSALHFYESKGLITSIRNSGNQRRYKRDVLRYVAIIKIAQRIGIPLATIGEAFGVLPEGHTLSAKEWKQLSSQWREELDRRIHTLVALRDELDGCIGCGCLSRSDCPLRNPGDRLGEEGTGARLLEDEQN 9A715120860EEC9B soxr-1 3169491 N/A 3169492 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false