DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ yang-2008-7 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. DIP original experiment: DIP-68186X PLoS biology 2008 IMEx Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. Only protein-protein interactions imex curation yang-2008-8 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. DIP original experiment: DIP-68181X PLoS biology 2008 IMEx Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. Only protein-protein interactions imex curation yang-2008-9 ecolx Escherichia coli nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. DIP original experiment: DIP-68183X PLoS biology 2008 IMEx Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. Only protein-protein interactions imex curation yang-2008-10 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. DIP original experiment: DIP-68184X PLoS biology 2008 IMEx Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. Only protein-protein interactions imex curation yang-2008-11 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. DIP original experiment: DIP-68187X PLoS biology 2008 IMEx Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. Only protein-protein interactions imex curation yang-2008-12 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. DIP original experiment: DIP-68185X PLoS biology 2008 IMEx Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. Only protein-protein interactions imex curation yang-2008-13 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. DIP original experiment: DIP-68182X PLoS biology 2008 IMEx Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. Only protein-protein interactions imex curation md2l1_human Mitotic spindle assembly checkpoint protein MAD2A MAD2L1 MAD2 Mitotic arrest deficient 2-like protein 1 protein protein human Homo sapiens Human MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND md1l1_human Mitotic spindle assembly checkpoint protein MAD1 Mitotic arrest deficient 1-like protein 1 Mitotic checkpoint MAD1 protein homolog Tax-binding protein 181 MAD1L1 MAD1 TXBP181 protein protein human Homo sapiens Human MEDLGENTMVLSTLRSLNNFISQRVEGGSGLDISTSAPGSLQMQYQQSMQLEERAEQIRSKSHLIQVEREKMQMELSHKRARVELERAASTSARNYEREVDRNQELLTRIRQLQEREAGAEEKMQEQLERNRQCQQNLDAASKRLREKEDSLAQAGETINALKGRISELQWSVMDQEMRVKRLESEKQELQEQLDLQHKKCQEANQKIQELQASQEARADHEQQIKDLEQKLSLQEQDAAIVKNMKSELVRLPRLERELKQLREESAHLREMRETNGLLQEELEGLQRKLGRQEKMQETLVGLELENERLLAKLQSWERLDQTMGLSIRTPEDLSRFVVELQQRELALKDKNSAVTSSARGLEKARQQLQEELRQVSGQLLEERKKRETHEALARRLQKRVLLLTKERDGMRAILGSYDSELTPAEYSPQLTRRMREAEDMVQKVHSHSAEMEAQLSQALEELGGQKQRADMLEMELKMLKSQSSSAEQSFLFSREEADTLRLKVEELEGERSRLEEEKRMLEAQLERRALQGDYDQSRTKVLHMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQTVA cdc20_human Cell division cycle protein 20 homolog CDC20 p55CDC protein protein human Homo sapiens Human MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR mad1l1-mad2l1-1 3168723 N/A 3168730 unspecified role unspecified role unspecified role unspecified role Region 495-718 Region 495-718 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3168731 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false cdc20-mad2l1-9 3168724 N/A 3168732 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3168730 unspecified role unspecified role unspecified role unspecified role Q13257:p.[Arg133Ala;Trp167Ala] R133A/W167A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q13257:p.[Trp75Ala;Arg133Ala] R133A/W75A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q13257:p.[Arg133Ala;Phe186Ala] R133A/F186A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q13257:p.[Arg133Ala;Thr188Ala] R133A/T188A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q13257:p.[Arg133Ala;His191Ala] R133A/H191A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q13257:p.[Arg133Ala;Val197Ala] R133A/V197A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q13257:p.[Arg133Ala;Tyr199Ala] R133A/Y199A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mad2l1-1 3168725 N/A 3168730 unspecified role unspecified role unspecified role unspecified role Q13257:p.[Leu13Ala;Cys79Ser;Cys106Ser] L13A/C79S/C106S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mad2l1-2 3168726 N/A 3168730 unspecified role unspecified role unspecified role unspecified role Q13257:p.[Leu13Ala;Cys79Ser;Cys106Ser] L13A/C79S/C106S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mad1l1-mad2l1-7 3168727 N/A 3168730 unspecified role unspecified role unspecified role unspecified role Region 495-718 Region 495-718 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3168731 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mad2l1-3 3168728 N/A 3168730 unspecified role unspecified role unspecified role unspecified role Q13257:p.[Leu13Ala;Cys79Ser;Cys106Ser] L13A/C79S/C106S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mad2l1-4 3168729 N/A 3168730 unspecified role unspecified role unspecified role unspecified role Q13257:p.[Leu13Ala;Cys79Ser;Cys106Ser] L13A/C79S/C106S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false