DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dieterich-2008-1 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. DIP original experiment: DIP-110883X PLoS biology 2008 IMEx Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. Only protein-protein interactions imex curation dieterich-2008-2 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. DIP original experiment: DIP-110878X PLoS biology 2008 IMEx Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. Only protein-protein interactions imex curation dieterich-2008-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. DIP original experiment: DIP-110876X PLoS biology 2008 IMEx Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. Only protein-protein interactions imex curation dieterich-2008-4 rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. DIP original experiment: DIP-110880X PLoS biology 2008 IMEx Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. Only protein-protein interactions imex curation dieterich-2008-5 rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. DIP original experiment: DIP-110881X PLoS biology 2008 IMEx Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. Only protein-protein interactions imex curation dieterich-2008-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. DIP original experiment: DIP-110877X PLoS biology 2008 IMEx Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. Only protein-protein interactions imex curation dieterich-2008-7 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. DIP original experiment: DIP-110879X PLoS biology 2008 IMEx Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. Only protein-protein interactions imex curation dieterich-2008-8 rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. DIP original experiment: DIP-110882X PLoS biology 2008 IMEx Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. Only protein-protein interactions imex curation q99nf2-1 NMDA receptor synaptonuclear signaling and neuronal migration factor Nsmf Jac Nelf Juxtasynaptic attractor of caldendrin on dendritic boutons protein Nasal embryonic luteinizing hormone-releasing hormone factor protein protein mouse Mus musculus Mouse MGAAASRRRALRSEAMSSVAAKVRAARAFGEYLSQSHPENRNGADHLLADAYSGHDGSPEMQPAPQNKRRLSLVSNGRYEGSISDEAVSGKPAIEGPQPHVYTISREPALLPGSEAEAIELAVVKGRRQRERHPHHHSQPLRASPGSSREDISRPCQSWAGSRQGSKECPGCAQLVPGPSSRAFGLEQPPLPEAPGRHKKLERMYSVDGVSDDVPIRTWFPKENLFSFQTATTTMQAISVFRGYAERKRRKRENDSASVIQRNFRKHLRMVGSRRVKAQTFAERRERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEACEDLDWDTEKGLEAMACNTEGFLPPKVMLISSKVPKAEYIPTIIRRDDPSIIPILYDHEHATFEDILEEIEKKLNIYHKGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYKVTFESPLELSAQGKQMIETYFDFRLYRLWKSRQHSKLLDFDDVL ima5_rat Importin subunit alpha-5 Kpna1 Importin alpha-5 Karyopherin subunit alpha-1 protein protein rat Rattus norvegicus (Rat) Rat MSTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMTEMIFSNSPEQQLSATQKFRKLLSKEPNPPIDEVINTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANMFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDAKIVQVALNGLENILRLGEQEAKRNGSGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLSQQQYIFQQCEAPMEGSQL q9epi6-1 NMDA receptor synaptonuclear signaling and neuronal migration factor Nsmf Jac Nelf Juxtasynaptic attractor of caldendrin on dendritic boutons protein Nasal embryonic luteinizing hormone-releasing hormone factor protein protein rat Rattus norvegicus (Rat) Rat MGAAASRRRALRSEAMSSVAAKVRAARAFGEYLSQSHPENRNGADHLLADAYSGHEGSPEMQPAPHNKRRLSLVSNGRYEGSISDEAVSGKTATEGPQPRVYTISREPALLPGSEAEAIELAVVKGRRQRERHPHHHSQPLRASPGSSREDISRPCQSWAGSRQGSKECPGCAKLVPGPSPRAFGLEQPPLPEASGRHKKLERMYSVDGVSDDVPIRTWFPKENPFSFQTATTTMQAISVFRGYAERKRRKRENDSASVIQRNFRKHLRMVGSRRVKAQTFAERRERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEACEDLDWDTEKGLEATACDTEGFLPPKVMLISSKVPKAEYIPTIIRRDDPSIIPILYDHEHATFEDILEEIEKKLNIYHKGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYKVTFESPLELSAQGKQMIETYFDFRLYRLWKSRQHSKLLDFDDVL o88751-1 Calcium-binding protein 1 Cabp1 Caldendrin protein protein rat Rattus norvegicus (Rat) Rat MSSHIAKSESKTSLLKAAAASGGSRAPRHSSARDPGLRGRRLPGPCPDSPATCGDPSSRRPLCRPVPRDEGARGSRRGLPQAHCRPRETLPPARGRDGEERGLAPALSLRGSLRSRGRGDPAPAGTPEADPFLHQLRPMLSSAFGQDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR Major isoform expressed in the brain. kpna1-nsmf-1 3168490 N/A 3168498 unspecified role unspecified role prey prey Region 247-252 Region 247-252 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3168499 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false cabp1-nsmf-1 3168491 N/A 3168500 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat N/A 3168501 unspecified role unspecified role bait bait Region 137-298 Region 137-298 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false cabp1-nsmf-2 3168492 N/A 3168501 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3168500 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false cabp1-nsmf-3 3168493 N/A 3168500 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat N/A 3168501 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat physical association physical association false false false nsmf-cabp1-1 3168494 N/A 3168500 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat N/A 3168501 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat physical association physical association false false false cabp1-nsmf-4 3168495 N/A 3168498 unspecified role unspecified role prey prey Region 1-249 Region 1-249 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q99NF2-1:p.Phe241Glu F241E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3168501 unspecified role unspecified role bait bait Region 65-229 Region 65-229 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false cabp1-nsmf-5 3168496 N/A 3168498 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey N/A 3168501 unspecified role unspecified role bait bait Region 137-298 Region 137-298 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false nsmf-kpna1-1 3168497 N/A 3168499 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat N/A 3168500 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat physical association physical association false false false