DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lee-2008-5 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lee KS., Bumbaca D., Kosman J., Setlow P., Jedrzejas MJ. DIP original experiment: DIP-68336X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Structure of a protein-DNA complex essential for DNA protection in spores of Bacillus species. Lee KS., Bumbaca D., Kosman J., Setlow P., Jedrzejas MJ. Only protein-protein interactions imex curation sspc_bacsu Small, acid-soluble spore protein C sspC BSU19950 protein protein bacsu Bacillus subtilis MAQQSRSRSNNNNDLLIPQAASAIEQMKLEIASEFGVQLGAETTSRANGSVGGEITKRLVRLAQQNMGGQFH F1E1788E86F28F8D sasp-1 3168103 N/A 3168104 unspecified role unspecified role unspecified role unspecified role Region 13-72 Region 13-72 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false