DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kusmierczyk-2008-1 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Kusmierczyk AR., Kunjappu MJ., Funakoshi M., Hochstrasser M. DIP original experiment: DIP-132518X Nature structural & molecular biology 2008 IMEx A multimeric assembly factor controls the formation of alternative 20S proteasomes. Kusmierczyk AR., Kunjappu MJ., Funakoshi M., Hochstrasser M. Only protein-protein interactions imex curation kusmierczyk-2008-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kusmierczyk AR., Kunjappu MJ., Funakoshi M., Hochstrasser M. DIP original experiment: DIP-132521X Nature structural & molecular biology 2008 IMEx A multimeric assembly factor controls the formation of alternative 20S proteasomes. Kusmierczyk AR., Kunjappu MJ., Funakoshi M., Hochstrasser M. Only protein-protein interactions imex curation kusmierczyk-2008-3 ecolx Escherichia coli comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Kusmierczyk AR., Kunjappu MJ., Funakoshi M., Hochstrasser M. DIP original experiment: DIP-132519X Nature structural & molecular biology 2008 IMEx A multimeric assembly factor controls the formation of alternative 20S proteasomes. Kusmierczyk AR., Kunjappu MJ., Funakoshi M., Hochstrasser M. Only protein-protein interactions imex curation kusmierczyk-2008-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Kusmierczyk AR., Kunjappu MJ., Funakoshi M., Hochstrasser M. DIP original experiment: DIP-132520X Nature structural & molecular biology 2008 IMEx A multimeric assembly factor controls the formation of alternative 20S proteasomes. Kusmierczyk AR., Kunjappu MJ., Funakoshi M., Hochstrasser M. Only protein-protein interactions imex curation poc4_yeast Proteasome chaperone 4 POC4 YPL144W DMP1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLVKTISRTIESESGFLQPTLDVIATLPADDRSKKIPISLVVGFKQEASLNSSSSLSCYYYAIPLMRDRHINLKSGGSNVVGIPLLDTKDDRIRDMARHMATIISERFNRPCYVTWSSLPSEDPSMLVANHLYILKKCLDLLKTELGE 1CC7C6074CF4AC08 poc3_yeast Proteasome chaperone 3 POC3 Increased recombination centers protein 25 IRC25 DMP2 YLR021W protein protein yeast Saccharomyces cerevisiae Baker's yeast MISYEFQTHLPKGKDSSLNASSENKELYVQATHFNNTILLQIRLNGEMDSTYEVSSKGLNPILDINVPLAGNLGNTGGDYDDEEEEFVRDHLSDYQVVTKLGDSADPKVPVVCVQIAELYRRVILPEVSGTMAQDNMQFSLLISMSSKIWRATKEQSADDNDFGKLVFVLKCIKDMYAK 6CA25E8ED0491EE2 psb7_yeast Proteasome subunit beta type-7 PRE4 YFR050C Macropain subunit PRE4 Proteinase YSCE subunit PRE4 Multicatalytic endopeptidase complex subunit PRE4 Proteasome component PRE4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNHDPFSWGRPADSTYGAYNTQIANAGASPMVNTQQPIVTGTSVISMKYDNGVIIAADNLGSYGSLLRFNGVERLIPVGDNTVVGISGDISDMQHIERLLKDLVTENAYDNPLADAEEALEPSYIFEYLATVMYQRRSKMNPLWNAIIVAGVQSNGDQFLRYVNLLGVTYSSPTLATGFGAHMANPLLRKVVDRESDIPKTTVQVAEEAIVNAMRVLYYRDARSSRNFSLAIIDKNTGLTFKKNLQVENMKWDFAKDIKGYGTQKI E585BB3B5D0C8E2C psb4_yeast Proteasome subunit beta type-4 PRE1 YER012W Proteasome component C11 Macropain subunit C11 Proteinase YSCE subunit 11 Multicatalytic endopeptidase complex subunit C11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDFQAQ ED43D319A5895B40 psa4_yeast Proteasome subunit alpha type-4 PRE6 YOL038W Proteasome component PRE6 Macropain subunit PRE6 Proteinase YSCE subunit PRE6 Multicatalytic endopeptidase complex subunit PRE6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQEQQEQDKKKKSNH 73AEE63B836E618A pba3-pba4-1 3167710 N/A 3167714 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3167715 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli physical association physical association false false false beta_4-alpha_4-1 3167711 N/A 3167716 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3167717 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3167718 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false pba3-pba4-2 3167712 N/A 3167714 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3167715 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false alpha_4-1 3167713 N/A 3167718 unspecified role unspecified role unspecified role unspecified role P40303:p.[Asn79Cys;Ile155Cys] N79C/I155C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false