DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ thomae-2008-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. DIP original experiment: DIP-68250X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. Only protein-protein interactions imex curation thomae-2008-2 human Homo sapiens Human bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. DIP original experiment: DIP-68255X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. Only protein-protein interactions imex curation thomae-2008-3 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. DIP original experiment: DIP-68253X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. Only protein-protein interactions imex curation thomae-2008-4 human Homo sapiens Human bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. DIP original experiment: DIP-68256X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. Only protein-protein interactions imex curation thomae-2008-5 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. DIP original experiment: DIP-68251X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. Only protein-protein interactions imex curation thomae-2008-6 human Homo sapiens Human bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. DIP original experiment: DIP-68254X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. Only protein-protein interactions imex curation thomae-2008-7 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. DIP original experiment: DIP-68252X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. Only protein-protein interactions imex curation thomae-2008-8 human Homo sapiens Human bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. DIP original experiment: DIP-68257X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction between HMGA1a and the origin recognition complex creates site-specific replication origins. Thomae AW., Pich D., Brocher J., Spindler MP., Berens C., Hock R., Hammerschmidt W., Schepers A. Only protein-protein interactions imex curation orc6_human Origin recognition complex subunit 6 ORC6 ORC6L protein protein human Homo sapiens Human MGSELIGRLAPRLGLAEPDMLRKAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMKCPLDRAYLIKLSGLNKETYQSCLKSFECLLGLNSNIGIRDLAVQFSCIEAVNMASKILKSYESSLPQTQQVDLDLSRPLFTSAALLSACKILKLKVDKNKMVATSGVKKAIFDRLCKQLEKIGQQVDREPGDVATPPRKRKKIVVEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE hmga1_human High mobility group protein HMG-I/HMG-Y High mobility group AT-hook protein 1 HMGA1 HMGIY High mobility group protein R protein protein human Homo sapiens Human MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ orc1_human Origin recognition complex subunit 1 ORC1 ORC1L PARC1 Replication control protein 1 protein protein human Homo sapiens Human MAHYPTRLKTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIGQFVLIEGDDDENPYVAKLLELFEDDSDPPPKKRARVQWFVRFCEVPACKRHLLGRKPGAQEIFWYDYPACDSNINAETIIGLVRVIPLAPKDVVPTNLKNEKTLFVKLSWNEKKFRPLSSELFAELNKPQESAAKCQKPVRAKSKSAESPSWTPAEHVAKRIESRHSASKSRQTPTHPLTPRARKRLELGNLGNPQMSQQTSCASLDSPGRIKRKVAFSEITSPSKRSQPDKLQTLSPALKAPEKTRETGLSYTEDDKKASPEHRIILRTRIAASKTIDIREERTLTPISGGQRSSVVPSVILKPENIKKRDAKEAKAQNEATSTPHRIRRKSSVLTMNRIRQQLRFLGNSKSDQEEKEILPAAEISDSSSDEEEASTPPLPRRAPRTVSRNLRSSLKSSLHTLTKVPKKSLKPRTPRCAAPQIRSRSLAAQEPASVLEEARLRLHVSAVPESLPCREQEFQDIYNFVESKLLDHTGGCMYISGVPGTGKTATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQVYVQILQKLTGQKATANHAAELLAKQFCTRGSPQETTVLLVDELDLLWTHKQDIMYNLFDWPTHKEARLVVLAIANTMDLPERIMMNRVSSRLGLTRMCFQPYTYSQLQQILRSRLKHLKAFEDDAIQLVARKVAALSGDARRCLDICRRATEICEFSQQKPDSPGLVTIAHSMEAVDEMFSSSYITAIKNSSVLEQSFLRAILAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRNDLLLRVRLNVSQDDVLYALKDE orc4_human Origin recognition complex subunit 4 ORC4 ORC4L protein protein human Homo sapiens Human MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFMTAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPNCPTDVRQWATSSLSWL orc2_human Origin recognition complex subunit 2 ORC2 ORC2L protein protein human Homo sapiens Human MSKPELKEDKMLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEEDDQEVLKDQNYVEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAKLASELAKTPQKSVSFSLKNDPEITINVPQSSKGHSASDKVQPKNNDKSEFLSTAPRSLRKRLIVPRSHSDSESEYSASNSEDDEGVAQEHEEDTNAVIFSQKIQAQNRVVSAPVGKETPSKRMKRDKTSDLVEEYFEAHSSSKVLTSDRTLQKLKRAKLDQQTLRNLLSKVSPSFSAELKQLNQQYEKLFHKWMLQLHLGFNIVLYGLGSKRDLLERFRTTMLQDSIHVVINGFFPGISVKSVLNSITEEVLDHMGTFRSILDQLDWIVNKFKEDSSLELFLLIHNLDSQMLRGEKSQQIIGQLSSLHNIYLIASIDHLNAPLMWDHAKQSLFNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLTHVLRSLTPNARGIFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDNGTLTDFLEKEEEEA orc5_human Origin recognition complex subunit 5 ORC5 ORC5L protein protein human Homo sapiens Human MPHLENVVLCRESQVSILQSLFGERHHFSFPSIFIYGHTASGKTYVTQTLLKTLELPHVFVNCVECFTLRLLLEQILNKLNHLSSSEDGCSTEITCETFNDFVRLFKQVTTAENLKDQTVYIVLDKAEYLRDMEANLLPGFLRLQELADRNVTVLFLSEIVWEKFRPNTGCFEPFVLYFPDYSIGNLQKILSHDHPPEYSADFYAAYINILLGVFYTVCRDLKELRHLAVLNFPKYCEPVVKGEASERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGLSAHTHVELPYYSKFILIAAYLASYNPARTDKRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLDRLLAILYSIVDSRVAPTANIFSQITSLVTLQLLTLVGHDDQLDGPKYKCTVSLDFIRAIARTVNFDIIKYLYDFL hmga1-orc6-1 3166887 N/A 3166895 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3166896 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false hmga1-orc1-1 3166888 N/A 3166897 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3166896 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false hmga1-orc6-2 3166889 N/A 3166895 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3166896 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction false false false orc4-orc6-2 3166890 N/A 3166895 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3166898 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false orc2-hmga1-1 3166891 N/A 3166896 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3166899 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false hmga1-orc6-3 3166892 N/A 3166895 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3166896 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false orc6-hmga1-1 3166893 N/A 3166896 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3166895 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false orc5-orc6-3 3166894 N/A 3166895 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human N/A 3166900 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction false false false