UniProt UniProt http://www.uniprot.org schluter-2008-1 yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Schluter C., Lam KK., Brumm J., Wu BW., Saunders M., Stevens TH., Bryan J., Conibear E. conibear@cmmt.ubc.ca, jenny@stat.ubc.ca Molecular biology of the cell 2008 imex curation Only protein-protein interactions imex curation schluter-2008-2 yeast Saccharomyces cerevisiae Baker's yeast fluorescence imaging fluorescence microscopy fluorescence imaging anti-tag immunocytochemistry anti-tag immunocytochemistry Schluter C., Lam KK., Brumm J., Wu BW., Saunders M., Stevens TH., Bryan J., Conibear E. conibear@cmmt.ubc.ca, jenny@stat.ubc.ca Molecular biology of the cell 2008 imex curation Only protein-protein interactions imex curation vps68_yeast Vacuolar protein sorting-associated protein 68 YOL129W VPS68 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEADDHVSLFRFPFKIPTFRGIRKGGVYLSGALYALGFWIFLDAVLYSRYSNASDVHVTFIDWIPFLCSTLGTLIVNSIEKNRLLQGALSSDGGAFGSGVGDLDSSMAWQARTVLFFGFALLAGGLSGSIVVLIIKFLVKDYNTYPTLGMGVNNVLGNVCILLSCVVLWIAQNVEDEYSYSLTL 4B21C846AB3BA2A7 vps55_yeast Vacuolar protein sorting-associated protein 55 J1637 YJR044C VPS55 protein protein yeast Saccharomyces cerevisiae Baker's yeast MMEFKVSPLTKIISLSGFLALGFLLVILSCALFHNYYPLFDILIFLLAPIPNTIFNAGNKYHTSDFMSDSSNTGQDLAHFLTGMLVTSGIALPVVFYHCQLIGHLSCIMCMIGGLIIYSSIVIFKWFFKKDFNEDDSLFG 1F207E62F093FC6D vps55-vps68-1 3322033 N/A 3322035 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3322036 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection over-expressed over expressed level over-expressed living cell living cell region au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3E, 3G vps68-vps55-1 3322034 N/A 3322035 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3322036 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection over-expressed over expressed level over-expressed living cell living cell region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 3A