DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ singh-2008-5 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Singh K., Kang PJ., Park HO. DIP original experiment: DIP-68232X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The Rho5 GTPase is necessary for oxidant-induced cell death in budding yeast. Singh K., Kang PJ., Park HO. Only protein-protein interactions imex curation singh-2008-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Singh K., Kang PJ., Park HO. DIP original experiment: DIP-68233X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The Rho5 GTPase is necessary for oxidant-induced cell death in budding yeast. Singh K., Kang PJ., Park HO. Only protein-protein interactions imex curation singh-2008-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Singh K., Kang PJ., Park HO. DIP original experiment: DIP-68234X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The Rho5 GTPase is necessary for oxidant-induced cell death in budding yeast. Singh K., Kang PJ., Park HO. Only protein-protein interactions imex curation trxb1_yeast Thioredoxin reductase 1 D9476.5 YDR353W TRR1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVHNKVTIIGSGPAAHTAAIYLARAEIKPILYEGMMANGIAAGGQLTTTTEIENFPGFPDGLTGSELMDRMREQSTKFGTEIITETVSKVDLSSKPFKLWTEFNEDAEPVTTDAIILATGASAKRMHLPGEETYWQKGISACAVCDGAVPIFRNKPLAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRASTIMQKRAEKNEKIEILYNTVALEAKGDGKLLNALRIKNTKKNEETDLPVSGLFYAIGHTPATKIVAGQVDTDEAGYIKTVPGSSLTSVPGFFAAGDVQDSKYRQAITSAGSGCMAALDAEKYLTSLE 9F9E58A4BAD859E1 rho5_yeast GTP-binding protein RHO5 RHO5 N1644 YNL180C protein protein yeast Saccharomyces cerevisiae Baker's yeast MRSIKCVIIGDGAVGKTSLLISYTTNSFPTDYVPTVFDNYSTTIAIPNGTASSPLELDNGNDKRGSLSSASSSPSTDRKLYKINLWDTAGQEDYDRLRPLCYPQTDIFLICFSVSEHASFANVTEKWLPELKQTSNIEGTSLYTKLGKYPILLVGTKSDLRDDPATQKKLQEANSDYVSQEEIDELVQRCGFMGYTECSAATQAGVREVFEQAVRYAIYEPESPNQKSANHTLTDELTTATTNTNGDKNIREQKQQPHHNNSTDSTLPKGSLQQEKEALNIKPTKKGQKDKIHEQSKSKGSKIASNNHHNKQAKPKTRNDKKKKKSKCVIL EEAFD4E39E7ACF81 rho5-trr1-1 3166572 N/A 3166575 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3166576 unspecified role unspecified role bait bait GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false rho5-trr1-2 3166573 N/A 3166575 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3166576 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false rho5-trr1-3 3166574 N/A 3166575 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3166576 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false