DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ tocilj-2008-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. DIP original experiment: DIP-113660X Nature structural & molecular biology 2008 IMEx Bacterial polysaccharide co-polymerases share a common framework for control of polymer length. Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. Only protein-protein interactions imex curation tocilj-2008-2 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. DIP original experiment: DIP-113674X Nature structural & molecular biology 2008 IMEx Bacterial polysaccharide co-polymerases share a common framework for control of polymer length. Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. Only protein-protein interactions imex curation tocilj-2008-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. DIP original experiment: DIP-113673X Nature structural & molecular biology 2008 IMEx Bacterial polysaccharide co-polymerases share a common framework for control of polymer length. Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. Only protein-protein interactions imex curation tocilj-2008-4 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. DIP original experiment: DIP-113667X Nature structural & molecular biology 2008 IMEx Bacterial polysaccharide co-polymerases share a common framework for control of polymer length. Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. Only protein-protein interactions imex curation tocilj-2008-5 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. DIP original experiment: DIP-113661X Nature structural & molecular biology 2008 IMEx Bacterial polysaccharide co-polymerases share a common framework for control of polymer length. Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. Only protein-protein interactions imex curation tocilj-2008-6 ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. DIP original experiment: DIP-113668X Nature structural & molecular biology 2008 IMEx Bacterial polysaccharide co-polymerases share a common framework for control of polymer length. Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. Only protein-protein interactions imex curation tocilj-2008-7 ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. DIP original experiment: DIP-113662X Nature structural & molecular biology 2008 IMEx Bacterial polysaccharide co-polymerases share a common framework for control of polymer length. Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. Only protein-protein interactions imex curation tocilj-2008-8 ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. DIP original experiment: DIP-113675X Nature structural & molecular biology 2008 IMEx Bacterial polysaccharide co-polymerases share a common framework for control of polymer length. Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. Only protein-protein interactions imex curation tocilj-2008-9 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. DIP original experiment: DIP-113669X Nature structural & molecular biology 2008 IMEx Bacterial polysaccharide co-polymerases share a common framework for control of polymer length. Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. Only protein-protein interactions imex curation tocilj-2008-10 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. DIP original experiment: DIP-113670X Nature structural & molecular biology 2008 IMEx Bacterial polysaccharide co-polymerases share a common framework for control of polymer length. Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. Only protein-protein interactions imex curation tocilj-2008-11 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. DIP original experiment: DIP-113663X Nature structural & molecular biology 2008 IMEx Bacterial polysaccharide co-polymerases share a common framework for control of polymer length. Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. Only protein-protein interactions imex curation tocilj-2008-12 ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. DIP original experiment: DIP-113671X Nature structural & molecular biology 2008 IMEx Bacterial polysaccharide co-polymerases share a common framework for control of polymer length. Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. Only protein-protein interactions imex curation tocilj-2008-13 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. DIP original experiment: DIP-113664X Nature structural & molecular biology 2008 IMEx Bacterial polysaccharide co-polymerases share a common framework for control of polymer length. Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. Only protein-protein interactions imex curation tocilj-2008-14 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. DIP original experiment: DIP-113676X Nature structural & molecular biology 2008 IMEx Bacterial polysaccharide co-polymerases share a common framework for control of polymer length. Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. Only protein-protein interactions imex curation tocilj-2008-15 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. DIP original experiment: DIP-113665X Nature structural & molecular biology 2008 IMEx Bacterial polysaccharide co-polymerases share a common framework for control of polymer length. Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. Only protein-protein interactions imex curation tocilj-2008-16 ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. DIP original experiment: DIP-113666X Nature structural & molecular biology 2008 IMEx Bacterial polysaccharide co-polymerases share a common framework for control of polymer length. Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. Only protein-protein interactions imex curation tocilj-2008-17 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. DIP original experiment: DIP-113672X Nature structural & molecular biology 2008 IMEx Bacterial polysaccharide co-polymerases share a common framework for control of polymer length. Tocilj A., Munger C., Proteau A., Morona R., Purins L., Ajamian E., Wagner J., Papadopoulos M., Van Den Bosch L., Rubinstein JL., Féthière J., Matte A., Cygler M. Only protein-protein interactions imex curation q8xbv8_eco57 E5F08_06535 fepE ECs_0626 protein protein eco57 Escherichia coli O157:H7 MSSLNIKQGSDAHFPDYPLASPSNNEIDLLNLISVLWRAKKTVMAVVFAFACAGLLISFILPQKWTSAAVVTPPEPVQWQELEKTFTKLRVLDLDIKIDRTEAFNLFIKKFQSVSLLEEYLRSSPYVMDQLKEAKIDELDLHRAIVALSEKMKAVDDNASKKKDEPSLYTSWTLSFTAPTSEEAQTVLSGYIDYISALVVKESIENVRNKLEIKTQFEKEKLAQDRIKMKNQLDANIQRLNYSLDIANAAGIKKPVYSNGQAVKDDPDFSISLGADGIERKLEIEKAVTDVAELNGELRNRQYLVEQLTKANINDVNFTPFKYQLSPSLPVKKDGPGKAIIVILSALIGGMVACGSVLLRYAMASRKQDAMMADHLV q8x8s6_eco57 E5F08_18090 wzzB ECs_2828 protein protein eco57 Escherichia coli O157:H7 MRVENNNVSGQNHDPEQIDLIDLLVQLWRGKMTIIISVIVAIALAIGYLAVAKEKWTSTAIITQPDVGQIAGYNNAMNVIYGQAAPKVSDLQETLIGRFSSAFSALAETLDNQEEPEKLTIEPSVKNQQLPLTVSYVGQTAEGAQMKLAQYIQQVDDKVNQELEKDLKDNIALGRKNLQDSLRTQEVVAQEQKELRIRQIQEALQYANQAQVAKPQVQQTEDVTQDTLFLLGSEALESMIKHEATRPLVFSPNYYQTRQNLLDIENLKVDDLDIHAYRYVMKPTLPIRRDSPKKAITLILAVLLGGMVGAGIVLGRNALRNYNAK wzze_eco57 ECA polysaccharide chain length modulation protein wzzE wzz Z5296 ECs4718 protein protein eco57 Escherichia coli O157:H7 MTQPMPGKPAEDAENELDIRGLFRTLWAGKLWIIGMGLAFALIALAYTFFARQEWSSTAITDRPTVNMLGGYYSQQQFLRNLDVRSNMASADQPSVMDEAYKEFVMQLASWDTRREFWLQTDYYKQRMVGNSKADAALLDEMINNIQFIPGDFTRAVNDSVKLIAETAPDANNLLRQYVAFASQRAASHLNDELKGAWAARTIQMKAQVKRQEEVAKAIYDRRMNSIEQALKIAEQHNISRSATDVPAEELPDSEMFLLGRPMLQARLENLQAVGPAFDLDYDQNRAMLNTLNVGPTLDPRFQTYRYLRTPEEPVKRDSPRRAFLMIMWGIVGGLIGAGVALTRRCSK wzzb_salty Chain length determinant protein wzzB Polysaccharide antigen chain regulator cld rol STM2079 protein protein salty Salmonella typhimurium MTVDSNTSSGRGNDPEQIDLIELLLQLWRGKMTIIVAVIIAILLAVGYLMIAKEKWTSTAIITQPDAAQVATYTNALNVLYGGNAPKISEVQANFISRFSSAFSALSEVLDNQKEREKLTIEQSVKGQALPLSVSYVSTTAEGAQRRLAEYIQQVDEEVAKELEVDLKDNITLQTKTLQESLETQEVVAQEQKDLRIKQIEEALRYADEAKITQPQIQQTQDVTQDTMFLLGSDALKSMIQNEATRPLVFSPAYYQTKQTLLDIKNLKVTADTVHVYRYVMKPTLPVRRDSPKTAITLVLAVLLGGMIGAGIVLGRNALRSYKPKAL 72D8BA8A3F4DF1A9 fepe-1 3166497 N/A 3166514 unspecified role unspecified role unspecified role unspecified role Region 65-331 Region 65-331 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false wzzb-1 3166498 N/A 3166515 unspecified role unspecified role unspecified role unspecified role Region 66-305 Region 66-305 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false wzzb-2 3166499 N/A 3166515 unspecified role unspecified role unspecified role unspecified role Region 66-305 Region 66-305 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false wzze-1 3166500 N/A 3166516 unspecified role unspecified role unspecified role unspecified role Region 54-322 Region 54-322 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false fepe-2 3166501 N/A 3166514 unspecified role unspecified role unspecified role unspecified role Region 65-331 Region 65-331 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false wzze-2 3166502 N/A 3166516 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false fepe-3 3166503 N/A 3166514 unspecified role unspecified role unspecified role unspecified role Region 65-331 Region 65-331 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false wzzb-3 3166504 N/A 3166515 unspecified role unspecified role unspecified role unspecified role Region 66-305 Region 66-305 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false wzzb(st)-1 3166505 N/A 3166517 unspecified role unspecified role unspecified role unspecified role Region 54-294 Region 54-294 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false wzzb(st)-2 3166506 N/A 3166517 unspecified role unspecified role unspecified role unspecified role Region 54-294 Region 54-294 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false fepe-4 3166507 N/A 3166514 unspecified role unspecified role unspecified role unspecified role Region 65-331 Region 65-331 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false wzzb(st)-3 3166508 N/A 3166517 unspecified role unspecified role unspecified role unspecified role Region 54-294 Region 54-294 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false wzze-3 3166509 N/A 3166516 unspecified role unspecified role unspecified role unspecified role Region 54-322 Region 54-322 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false wzzb-4 3166510 N/A 3166515 unspecified role unspecified role unspecified role unspecified role Region 66-305 Region 66-305 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false wzze-4 3166511 N/A 3166516 unspecified role unspecified role unspecified role unspecified role Region 54-322 Region 54-322 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false wzze-5 3166512 N/A 3166516 unspecified role unspecified role unspecified role unspecified role Region 54-322 Region 54-322 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false wzzb(st)-4 3166513 N/A 3166517 unspecified role unspecified role unspecified role unspecified role Region 54-294 Region 54-294 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false